BLASTX nr result
ID: Chrysanthemum21_contig00027044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027044 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF91846.1| hypothetical protein HannXRQ_Chr16g0515411 [Helia... 60 2e-09 >gb|OTF91846.1| hypothetical protein HannXRQ_Chr16g0515411 [Helianthus annuus] Length = 71 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = +1 Query: 67 MVTKVTLVRFMILFIALASVVVWSYAAN-----HVTGST-INPQAGCRCCNFVYEKSLIT 228 MVT+ TL RF++ F+ +AS +YA + H T I+PQAGCRCCNFVY+K I Sbjct: 1 MVTRATLARFLVWFLVVASTAASTYATSGPKVLHPAADTSIHPQAGCRCCNFVYQKPFIQ 60 Query: 229 WKSLLC 246 + C Sbjct: 61 CGRVCC 66 Score = 29.3 bits (64), Expect(2) = 2e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 230 GKVCCVDGCC 259 G+VCCVDGCC Sbjct: 62 GRVCCVDGCC 71