BLASTX nr result
ID: Chrysanthemum21_contig00026734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026734 (816 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022010415.1| auxin transport protein BIG [Helianthus annu... 62 5e-07 >ref|XP_022010415.1| auxin transport protein BIG [Helianthus annuus] gb|OTF93764.1| putative auxin transport protein (BIG) [Helianthus annuus] Length = 5084 Score = 62.0 bits (149), Expect = 5e-07 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 695 VESYGGVGTKMQFSTDDISDPMLLPLASDAGMPTSAPAIH 814 VE+YGG G +MQFSTDD++DPMLLP+ASDAGM TS AIH Sbjct: 2655 VETYGGEGNEMQFSTDDLTDPMLLPVASDAGMQTST-AIH 2693