BLASTX nr result
ID: Chrysanthemum21_contig00026654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026654 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93099.1| Ran GTPase, partial [Cynara cardunculus var. scol... 67 4e-10 >gb|KVH93099.1| Ran GTPase, partial [Cynara cardunculus var. scolymus] Length = 825 Score = 66.6 bits (161), Expect = 4e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 50 ATLELLERMGVAKVKPRKIQQVYEIWTRKDYAVTKNKRSS 169 ATLELLE MGVAKVK RKIQ VYEIW +K++AVTKN+RSS Sbjct: 168 ATLELLEHMGVAKVKRRKIQHVYEIWMKKNFAVTKNRRSS 207