BLASTX nr result
ID: Chrysanthemum21_contig00026547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026547 (1135 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017222748.1| PREDICTED: uncharacterized protein LOC108199... 65 5e-08 ref|XP_021990486.1| transcription initiation factor TFIID subuni... 59 6e-06 >ref|XP_017222748.1| PREDICTED: uncharacterized protein LOC108199448 isoform X2 [Daucus carota subsp. sativus] ref|XP_017222749.1| PREDICTED: uncharacterized protein LOC108199448 isoform X2 [Daucus carota subsp. sativus] Length = 353 Score = 65.5 bits (158), Expect = 5e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 161 YFNALDLTGFSGYRMRAGSASPDRRRNGSREYSPDYENSVSPP 33 YFN+LD+TGFSGYR+RAGSASP RRR R YSP++++ PP Sbjct: 7 YFNSLDITGFSGYRVRAGSASPVRRRTTERRYSPEFDHQNGPP 49 >ref|XP_021990486.1| transcription initiation factor TFIID subunit 15b isoform X2 [Helianthus annuus] Length = 332 Score = 58.9 bits (141), Expect = 6e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 143 LTGFSGYRMRAGSASPDRRRNGSREYSPDYENSVSPP 33 L GFSGYRMRAGS SP RRRNGS YSPDY++S P Sbjct: 21 LDGFSGYRMRAGSVSPVRRRNGSHHYSPDYDHSDGAP 57