BLASTX nr result
ID: Chrysanthemum21_contig00026521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026521 (1118 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_100025424.1| hypothetical protein [Fusobacterium periodon... 61 2e-06 ref|WP_099959520.1| hypothetical protein [Fusobacterium periodon... 61 2e-06 >ref|WP_100025424.1| hypothetical protein [Fusobacterium periodonticum] gb|ATV60174.1| hypothetical protein CTM72_10945 [Fusobacterium periodonticum] Length = 393 Score = 60.8 bits (146), Expect = 2e-06 Identities = 38/112 (33%), Positives = 66/112 (58%), Gaps = 3/112 (2%) Frame = -3 Query: 441 KATGVEKKKEQAPDVEKDKASVVVIYKKKVPTVLK--DKSPVTK-DKPKNRSSKVEIPVK 271 K T +EKK P+V K++ + VV KK++ K +K +TK ++PK KVE P Sbjct: 146 KETTIEKK----PEVPKEEKAPVVNDKKELKAEAKTEEKKAITKSEEPKKEEKKVEKPKA 201 Query: 270 DKSPVIKGKPKDKSSKVETKSVEAVQAEDKPKQKRVLSKVDESKKTEGQAAK 115 + K KPK+ +S+ +T++ + V++E K +K+ ++K +E+KK E + K Sbjct: 202 ETKVEEKAKPKEATSEKKTETPKEVKSETKTDEKKPVAKTEEAKKEEKKVEK 253 >ref|WP_099959520.1| hypothetical protein [Fusobacterium periodonticum] gb|PIM80953.1| hypothetical protein CTM71_11560 [Fusobacterium periodonticum] Length = 393 Score = 60.8 bits (146), Expect = 2e-06 Identities = 38/112 (33%), Positives = 66/112 (58%), Gaps = 3/112 (2%) Frame = -3 Query: 441 KATGVEKKKEQAPDVEKDKASVVVIYKKKVPTVLK--DKSPVTK-DKPKNRSSKVEIPVK 271 K T +EKK P+V K++ + VV KK++ K +K +TK ++PK KVE P Sbjct: 146 KETTIEKK----PEVPKEEKAPVVNDKKELKAEAKTEEKEAITKSEEPKKEEKKVEKPKA 201 Query: 270 DKSPVIKGKPKDKSSKVETKSVEAVQAEDKPKQKRVLSKVDESKKTEGQAAK 115 + K KPK+ +S+ +T++ + V++E K +K+ ++K +E+KK E + K Sbjct: 202 ETKVEEKAKPKEATSEKKTETPKEVKSETKTDEKKPVAKTEEAKKEEKKVEK 253