BLASTX nr result
ID: Chrysanthemum21_contig00026314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026314 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022037078.1| calcium-dependent protein kinase 7-like [Hel... 56 2e-06 gb|KVH94742.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 55 8e-06 >ref|XP_022037078.1| calcium-dependent protein kinase 7-like [Helianthus annuus] gb|OTG24020.1| putative serine/threonine/dual specificity protein kinase, catalytic domain-containing protein [Helianthus annuus] Length = 530 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 198 LDGHEQAREDIVELKAGLQKLGHQIPDADLQILMEA 91 +D ++Q + +IVELKAGLQKLGH IPDADLQILMEA Sbjct: 367 MDVNKQGKINIVELKAGLQKLGHHIPDADLQILMEA 402 >gb|KVH94742.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 522 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 198 LDGHEQAREDIVELKAGLQKLGHQIPDADLQILMEA 91 +D +Q + +IVELKAGLQKLGHQI DADLQILMEA Sbjct: 359 MDTSKQGKINIVELKAGLQKLGHQIADADLQILMEA 394