BLASTX nr result
ID: Chrysanthemum21_contig00026292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026292 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023739303.1| secretory carrier-associated membrane protei... 58 2e-07 gb|OTG29760.1| putative secretory carrier-associated membrane pr... 56 1e-06 ref|XP_022036196.1| secretory carrier-associated membrane protei... 56 1e-06 ref|XP_022017560.1| secretory carrier-associated membrane protei... 55 2e-06 ref|XP_017254144.1| PREDICTED: secretory carrier-associated memb... 54 2e-06 ref|XP_023731444.1| secretory carrier-associated membrane protei... 55 3e-06 ref|XP_023731438.1| secretory carrier-associated membrane protei... 55 3e-06 ref|XP_002517970.1| PREDICTED: secretory carrier-associated memb... 54 4e-06 ref|XP_017235200.1| PREDICTED: secretory carrier-associated memb... 54 6e-06 gb|KZN11474.1| hypothetical protein DCAR_004130 [Daucus carota s... 54 7e-06 ref|XP_017221280.1| PREDICTED: secretory carrier-associated memb... 54 8e-06 ref|XP_022041655.1| secretory carrier-associated membrane protei... 54 8e-06 ref|XP_020214221.1| secretory carrier-associated membrane protei... 54 8e-06 ref|XP_023758267.1| secretory carrier-associated membrane protei... 54 8e-06 gb|KYP68831.1| Secretory carrier-associated membrane protein 1 [... 54 9e-06 gb|EXB62280.1| Secretory carrier-associated membrane protein 1 [... 53 1e-05 >ref|XP_023739303.1| secretory carrier-associated membrane protein 3-like [Lactuca sativa] gb|PLY69574.1| hypothetical protein LSAT_4X56060 [Lactuca sativa] Length = 297 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDLVGDQALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 245 VDLVGDQALVGIFYFLGFGLFCLESLLSIWVIQQVYMYFRGS 286 >gb|OTG29760.1| putative secretory carrier-associated membrane protein 2 [Helianthus annuus] Length = 298 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 238 VDLIGDHALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGS 279 >ref|XP_022036196.1| secretory carrier-associated membrane protein 2-like [Helianthus annuus] Length = 309 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 249 VDLIGDHALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGS 290 >ref|XP_022017560.1| secretory carrier-associated membrane protein 2-like [Helianthus annuus] gb|OTF92078.1| putative secretory carrier-associated membrane protein 4 [Helianthus annuus] Length = 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD+A+V FC EALLS+WVIQQVYMYFRG+ Sbjct: 242 VDLIGDEAIVGIFYFIGFGLFCCEALLSVWVIQQVYMYFRGS 283 >ref|XP_017254144.1| PREDICTED: secretory carrier-associated membrane protein 5-like [Daucus carota subsp. sativus] Length = 158 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD A+V FC+E++LSIWVIQQVYMYFRG+ Sbjct: 98 VDLIGDHAIVGIFYFVGFGLFCLESVLSIWVIQQVYMYFRGS 139 >ref|XP_023731444.1| secretory carrier-associated membrane protein 2-like isoform X2 [Lactuca sativa] Length = 306 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDLVGD ALV FC+E+LLSIWVIQQV+MYFRG+ Sbjct: 246 VDLVGDHALVGIFYFVGFGLFCLESLLSIWVIQQVFMYFRGS 287 >ref|XP_023731438.1| secretory carrier-associated membrane protein 2-like isoform X1 [Lactuca sativa] gb|PLY97503.1| hypothetical protein LSAT_1X125001 [Lactuca sativa] Length = 307 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDLVGD ALV FC+E+LLSIWVIQQV+MYFRG+ Sbjct: 247 VDLVGDHALVGIFYFVGFGLFCLESLLSIWVIQQVFMYFRGS 288 >ref|XP_002517970.1| PREDICTED: secretory carrier-associated membrane protein 1 [Ricinus communis] gb|EEF44488.1| secretory carrier membrane protein, putative [Ricinus communis] Length = 299 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 +DL+GD ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 239 IDLLGDHALVGIFYFIGFGCFCVESLLSIWVIQQVYMYFRGS 280 >ref|XP_017235200.1| PREDICTED: secretory carrier-associated membrane protein 2-like [Daucus carota subsp. sativus] Length = 289 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD A+V FC+E++LSIWVIQQVYMYFRG+ Sbjct: 229 VDLIGDHAIVGIFYFVGFGLFCLESVLSIWVIQQVYMYFRGS 270 >gb|KZN11474.1| hypothetical protein DCAR_004130 [Daucus carota subsp. sativus] Length = 393 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD A+V FC+E++LSIWVIQQVYMYFRG+ Sbjct: 229 VDLIGDHAIVGIFYFVGFGLFCLESVLSIWVIQQVYMYFRGS 270 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDL+GD A+V FC+E++LSIWVIQQVYMYFRG+ Sbjct: 333 VDLIGDHAIVGIFYFVGFGLFCLESVLSIWVIQQVYMYFRGS 374 >ref|XP_017221280.1| PREDICTED: secretory carrier-associated membrane protein 2-like [Daucus carota subsp. sativus] gb|KZM84449.1| hypothetical protein DCAR_028129 [Daucus carota subsp. sativus] Length = 280 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRG 236 VDLVGD A+V FC+E+ LSIWVIQQVYMYFRG Sbjct: 225 VDLVGDNAIVGIFYFVGAGLFCLESFLSIWVIQQVYMYFRG 265 >ref|XP_022041655.1| secretory carrier-associated membrane protein 2-like isoform X1 [Helianthus annuus] gb|OTG36090.1| putative secretory carrier-associated membrane protein 1 [Helianthus annuus] Length = 304 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDLVG ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 244 VDLVGKHALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGS 285 >ref|XP_020214221.1| secretory carrier-associated membrane protein 1-like [Cajanus cajan] Length = 306 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 +D++GD ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 246 IDVLGDNALVGIFYFIGFGFFCLESLLSIWVIQQVYMYFRGS 287 >ref|XP_023758267.1| secretory carrier-associated membrane protein 2-like [Lactuca sativa] ref|XP_023758275.1| secretory carrier-associated membrane protein 2-like [Lactuca sativa] gb|PLY98831.1| hypothetical protein LSAT_7X19881 [Lactuca sativa] Length = 308 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 VDLVG ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 248 VDLVGKHALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGS 289 >gb|KYP68831.1| Secretory carrier-associated membrane protein 1 [Cajanus cajan] Length = 352 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 +D++GD ALV FC+E+LLSIWVIQQVYMYFRG+ Sbjct: 292 IDVLGDNALVGIFYFIGFGFFCLESLLSIWVIQQVYMYFRGS 333 >gb|EXB62280.1| Secretory carrier-associated membrane protein 1 [Morus notabilis] Length = 261 Score = 53.1 bits (126), Expect = 1e-05 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -1 Query: 358 VDLVGDQALVXXXXXXXXXXFCMEALLSIWVIQQVYMYFRGN 233 +D++GD ALV FC+E+LLS+WVIQQVYMYFRG+ Sbjct: 201 IDVLGDHALVGIFYFIGFGLFCLESLLSVWVIQQVYMYFRGS 242