BLASTX nr result
ID: Chrysanthemum21_contig00026054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026054 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009544096.1| hypothetical protein HETIRDRAFT_473013 [Hete... 112 2e-29 ref|XP_003194203.1| ribosomal protein, putative [Cryptococcus ga... 112 2e-29 gb|OCF37130.1| 30S small subunit ribosomal protein S25e [Kwoniel... 112 2e-29 gb|KNE90223.1| S25 ribosomal protein [Puccinia striiformis f. sp... 112 2e-29 gb|PLW22582.1| hypothetical protein PCASD_14026 [Puccinia corona... 112 2e-29 ref|XP_003330158.1| 40S ribosomal protein S25 [Puccinia graminis... 112 2e-29 ref|XP_013245952.1| hypothetical protein K437DRAFT_116506 [Tille... 112 2e-29 ref|XP_570824.1| ribosomal protein [Cryptococcus neoformans var.... 111 4e-29 gb|PLW41749.1| hypothetical protein PCASD_05695 [Puccinia corona... 112 3e-28 ref|XP_019003599.1| 30S small subunit ribosomal protein S25e [Kw... 108 4e-28 gb|ODN91135.1| 30S small subunit ribosomal protein S25e [Cryptoc... 108 4e-28 ref|XP_018260410.1| 30S small subunit ribosomal protein S25e [Kw... 108 4e-28 gb|KNZ56907.1| S25 ribosomal protein [Puccinia sorghi] 112 5e-28 ref|XP_019032929.1| 30S small subunit ribosomal protein S25e [Ts... 108 6e-28 gb|OCF61926.1| 30S small subunit ribosomal protein S25e [Kwoniel... 108 6e-28 ref|XP_016291927.1| 40S ribosomal protein S25 [Kalmanozyma brasi... 107 1e-27 ref|XP_019009194.1| 30S small subunit ribosomal protein S25e [Kw... 107 1e-27 ref|XP_007880595.1| hypothetical protein PFL1_04876 [Anthracocys... 107 2e-27 gb|EKC98292.1| ribosomal protein [Trichosporon asahii var. asahi... 107 2e-27 emb|CDS02089.1| hypothetical protein [Sporisorium scitamineum] >... 106 3e-27 >ref|XP_009544096.1| hypothetical protein HETIRDRAFT_473013 [Heterobasidion irregulare TC 32-1] gb|ETW84422.1| hypothetical protein HETIRDRAFT_473013 [Heterobasidion irregulare TC 32-1] Length = 104 Score = 112 bits (280), Expect = 2e-29 Identities = 52/72 (72%), Positives = 65/72 (90%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 A +AVM+DKPTYD+ILKEVPT+++ISQSILIER+K+NGS+AR A+R LE G IKR+VHH Sbjct: 31 AQHAVMIDKPTYDRILKEVPTFRLISQSILIERLKVNGSLARVAIRHLEKEGTIKRIVHH 90 Query: 200 HGQWVYTRATAS 165 HGQ +YTR+TAS Sbjct: 91 HGQLIYTRSTAS 102 >ref|XP_003194203.1| ribosomal protein, putative [Cryptococcus gattii WM276] ref|XP_012050100.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii H99] gb|ADV22416.1| ribosomal protein, putative [Cryptococcus gattii WM276] gb|AFR95470.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii H99] gb|KGB77984.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII R265] gb|KIR29451.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII LA55] gb|KIR34586.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII MMRL2647] gb|KIR39478.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII Ram5] gb|KIR46870.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii CA1280] gb|KIR56591.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii Ru294] gb|KIR60094.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii CA1873] gb|KIR73813.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII CA1014] gb|KIR78506.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii EJB2] gb|KIR85819.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGIV IND107] gb|KIR93305.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII CBS 10090] gb|KIR99432.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII 2001/935-1] gb|KIY34686.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii E566] gb|KIY59108.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii VGII 99/473] gb|KJE04965.1| 30S small subunit ribosomal protein S25e [Cryptococcus gattii NT-10] gb|OWT39374.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Bt1] gb|OWZ31542.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii AD2-60a] gb|OWZ42672.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii AD1-83a] gb|OWZ43703.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii C23] gb|OWZ43952.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii c45] gb|OWZ54387.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii 125.91] gb|OWZ61418.1| hypothetical protein AYX15_06366 [Cryptococcus neoformans var. grubii] gb|OWZ64971.1| hypothetical protein AYX14_06337 [Cryptococcus neoformans var. grubii] gb|OWZ77887.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Bt85] gb|OXB36946.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXC61169.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii MW-RSA852] gb|OXC68751.1| hypothetical protein AYX13_02677 [Cryptococcus neoformans var. grubii] gb|OXC84359.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii AD1-7a] gb|OXG17396.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Tu401-1] gb|OXG20800.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Tu259-1] gb|OXG25439.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Ze90-1] gb|OXG32795.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Bt15] gb|OXG41468.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Bt120] gb|OXG50039.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Th84] gb|OXG58948.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii MW-RSA1955] gb|OXG63526.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii c8] gb|OXG63921.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii CHC193] gb|OXG80864.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii MW-RSA36] gb|OXG82196.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Br795] gb|OXG87042.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii D17-1] gb|OXG95776.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii A2-102-5] gb|OXH10239.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii A5-35-17] gb|OXH10750.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH11688.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii A1-35-8] gb|OXH31471.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH32141.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH32226.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH51062.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH51742.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH51963.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH69887.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXH69959.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii] gb|OXL08268.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Gb118] gb|OXM78974.1| small subunit ribosomal protein S25e [Cryptococcus neoformans var. grubii Bt63] gb|AUB25278.1| hypothetical protein CKF44_002116 [Cryptococcus neoformans var. grubii] Length = 107 Score = 112 bits (280), Expect = 2e-29 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV+VDK YD+ILKEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE GLIKRVVHH Sbjct: 36 ANNAVVVDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >gb|OCF37130.1| 30S small subunit ribosomal protein S25e [Kwoniella heveanensis BCC8398] gb|OCF46060.1| 30S small subunit ribosomal protein S25e [Kwoniella heveanensis CBS 569] Length = 109 Score = 112 bits (280), Expect = 2e-29 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV+VDK YD+ILKEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE GLIKRVVHH Sbjct: 36 ANNAVVVDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >gb|KNE90223.1| S25 ribosomal protein [Puccinia striiformis f. sp. tritici PST-78] gb|POW01019.1| hypothetical protein PSHT_12758 [Puccinia striiformis] gb|POW11200.1| hypothetical protein PSTT_05430 [Puccinia striiformis] Length = 100 Score = 112 bits (279), Expect = 2e-29 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANN V+ DKPTYDKI KEVPTYKMISQS+LI+RMKINGS+AR A++ LE GLIKR+VHH Sbjct: 27 ANNHVVCDKPTYDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHH 86 Query: 200 HGQWVYTRATAS 165 GQ VYTRATA+ Sbjct: 87 RGQLVYTRATAA 98 >gb|PLW22582.1| hypothetical protein PCASD_14026 [Puccinia coronata var. avenae f. sp. avenae] gb|PLW42404.1| hypothetical protein PCANC_09897 [Puccinia coronata var. avenae f. sp. avenae] Length = 101 Score = 112 bits (279), Expect = 2e-29 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANN V+ DKPTYDKI KEVPTYKMISQS+LI+RMKINGS+AR A++ LE GLIKR+VHH Sbjct: 28 ANNHVICDKPTYDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHH 87 Query: 200 HGQWVYTRATAS 165 GQ VYTRATA+ Sbjct: 88 RGQLVYTRATAA 99 >ref|XP_003330158.1| 40S ribosomal protein S25 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gb|EFP85739.1| S25 ribosomal protein [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 101 Score = 112 bits (279), Expect = 2e-29 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANN V+ DKPTYDKI KEVPTYKMISQS+LI+RMKINGS+AR A++ LE GLIKR+VHH Sbjct: 28 ANNHVVCDKPTYDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHH 87 Query: 200 HGQWVYTRATAS 165 GQ VYTRATA+ Sbjct: 88 RGQLVYTRATAA 99 >ref|XP_013245952.1| hypothetical protein K437DRAFT_116506 [Tilletiaria anomala UBC 951] gb|KDN53113.1| hypothetical protein K437DRAFT_116506 [Tilletiaria anomala UBC 951] Length = 127 Score = 112 bits (281), Expect = 2e-29 Identities = 52/73 (71%), Positives = 65/73 (89%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 A N+V++DKPTYDKILKEVPT+KMISQS LI+R+K+NGS+AR+A+R LE G IKR++HH Sbjct: 55 AQNSVVLDKPTYDKILKEVPTFKMISQSTLIDRLKVNGSLARRAIRHLEKEGQIKRIIHH 114 Query: 200 HGQWVYTRATASD 162 HGQ VYTRA+ SD Sbjct: 115 HGQLVYTRASGSD 127 >ref|XP_570824.1| ribosomal protein [Cryptococcus neoformans var. neoformans JEC21] ref|XP_775472.1| 40S ribosomal protein S25 [Cryptococcus neoformans var. neoformans B-3501A] gb|EAL20825.1| hypothetical protein CNBE1870 [Cryptococcus neoformans var. neoformans B-3501A] gb|AAW43517.1| ribosomal protein, putative [Cryptococcus neoformans var. neoformans JEC21] Length = 107 Score = 111 bits (278), Expect = 4e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV+VDK YD+I+KEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE GLIKRVVHH Sbjct: 36 ANNAVIVDKAVYDRIIKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >gb|PLW41749.1| hypothetical protein PCASD_05695 [Puccinia coronata var. avenae f. sp. avenae] Length = 193 Score = 112 bits (279), Expect = 3e-28 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANN V+ DKPTYDKI KEVPTYKMISQS+LI+RMKINGS+AR A++ LE GLIKR+VHH Sbjct: 120 ANNHVICDKPTYDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHH 179 Query: 200 HGQWVYTRATAS 165 GQ VYTRATA+ Sbjct: 180 RGQLVYTRATAA 191 >ref|XP_019003599.1| 30S small subunit ribosomal protein S25e [Kwoniella mangroviensis CBS 8507] gb|OCF67060.1| 30S small subunit ribosomal protein S25e [Kwoniella mangroviensis CBS 8507] gb|OCF77945.1| 30S small subunit ribosomal protein S25e [Kwoniella mangroviensis CBS 8886] Length = 94 Score = 108 bits (270), Expect = 4e-28 Identities = 52/72 (72%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DK YD+ILKEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE G IKRVVHH Sbjct: 21 ANNAVVLDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGHIKRVVHH 80 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 81 HAQLIYTRATAA 92 >gb|ODN91135.1| 30S small subunit ribosomal protein S25e [Cryptococcus depauperatus CBS 7841] Length = 109 Score = 108 bits (271), Expect = 4e-28 Identities = 52/71 (73%), Positives = 63/71 (88%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV+VDK +D+I+KEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE GLIKRVVHH Sbjct: 36 ANNAVVVDKAIFDRIVKEVPTYKLISQSVLIDRMKINGSLARRAIAYLEKEGLIKRVVHH 95 Query: 200 HGQWVYTRATA 168 H Q +YTRATA Sbjct: 96 HAQLIYTRATA 106 >ref|XP_018260410.1| 30S small subunit ribosomal protein S25e [Kwoniella dejecticola CBS 10117] gb|OBR82568.1| 30S small subunit ribosomal protein S25e [Kwoniella dejecticola CBS 10117] Length = 109 Score = 108 bits (271), Expect = 4e-28 Identities = 52/72 (72%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DK YD+ILKEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE G IKRVVHH Sbjct: 36 ANNAVVLDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGQIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >gb|KNZ56907.1| S25 ribosomal protein [Puccinia sorghi] Length = 215 Score = 112 bits (279), Expect = 5e-28 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANN V+ DKPTYDKI KEVPTYKMISQS+LI+RMKINGS+AR A++ LE GLIKR+VHH Sbjct: 142 ANNHVICDKPTYDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHH 201 Query: 200 HGQWVYTRATAS 165 GQ VYTRATA+ Sbjct: 202 RGQLVYTRATAA 213 >ref|XP_019032929.1| 30S small subunit ribosomal protein S25e [Tsuchiyaea wingfieldii CBS 7118] gb|ODO00737.1| 30S small subunit ribosomal protein S25e [Tsuchiyaea wingfieldii CBS 7118] Length = 109 Score = 108 bits (270), Expect = 6e-28 Identities = 51/71 (71%), Positives = 64/71 (90%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DKP +D+I+KEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE GLIKRVVHH Sbjct: 36 ANNAVILDKPVFDRIVKEVPTYKLISQSVLIDRMKINGSLARRAIAYLEKEGLIKRVVHH 95 Query: 200 HGQWVYTRATA 168 + Q +YTRATA Sbjct: 96 NAQLIYTRATA 106 >gb|OCF61926.1| 30S small subunit ribosomal protein S25e [Kwoniella mangroviensis CBS 10435] Length = 109 Score = 108 bits (270), Expect = 6e-28 Identities = 52/72 (72%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DK YD+ILKEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE G IKRVVHH Sbjct: 36 ANNAVVLDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGHIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >ref|XP_016291927.1| 40S ribosomal protein S25 [Kalmanozyma brasiliensis GHG001] gb|EST06938.1| 40S ribosomal protein S25 [Kalmanozyma brasiliensis GHG001] Length = 101 Score = 107 bits (268), Expect = 1e-27 Identities = 52/71 (73%), Positives = 62/71 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 A N V++DKPTYD+ILKEVPT+KMISQS LI+RMKINGS+AR A+R LE G IKR++HH Sbjct: 30 AQNMVVLDKPTYDRILKEVPTFKMISQSTLIDRMKINGSLARVAIRHLERDGQIKRIIHH 89 Query: 200 HGQWVYTRATA 168 HGQ VYTRA+A Sbjct: 90 HGQLVYTRASA 100 >ref|XP_019009194.1| 30S small subunit ribosomal protein S25e [Kwoniella pini CBS 10737] gb|OCF47975.1| 30S small subunit ribosomal protein S25e [Kwoniella pini CBS 10737] Length = 109 Score = 107 bits (268), Expect = 1e-27 Identities = 51/72 (70%), Positives = 63/72 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DK YD+I+KEVPTYK+ISQS+LI+RMKINGS+AR+A+ LE G IKRVVHH Sbjct: 36 ANNAVVLDKAVYDRIIKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGHIKRVVHH 95 Query: 200 HGQWVYTRATAS 165 H Q +YTRATA+ Sbjct: 96 HAQLIYTRATAA 107 >ref|XP_007880595.1| hypothetical protein PFL1_04876 [Anthracocystis flocculosa PF-1] gb|EPQ27739.1| hypothetical protein PFL1_04876 [Anthracocystis flocculosa PF-1] Length = 101 Score = 107 bits (266), Expect = 2e-27 Identities = 51/71 (71%), Positives = 62/71 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 A N V++D+PTYD+ILKEVPT+KMISQS LI+RMKINGS+AR A+R LE G IKR++HH Sbjct: 30 AQNMVVLDRPTYDRILKEVPTFKMISQSTLIDRMKINGSLARVAIRHLEREGQIKRIIHH 89 Query: 200 HGQWVYTRATA 168 HGQ VYTRA+A Sbjct: 90 HGQLVYTRASA 100 >gb|EKC98292.1| ribosomal protein [Trichosporon asahii var. asahii CBS 8904] Length = 129 Score = 107 bits (268), Expect = 2e-27 Identities = 49/73 (67%), Positives = 64/73 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 ANNAV++DK YD+I+KEVPTYK+ISQS+LI+RMK+NGS+AR+A+ LE GLIK+VV H Sbjct: 57 ANNAVVLDKNIYDRIMKEVPTYKLISQSVLIDRMKVNGSLARRAIIHLEKEGLIKKVVKH 116 Query: 200 HGQWVYTRATASD 162 H QW+YTRA+A + Sbjct: 117 HAQWIYTRASAKE 129 >emb|CDS02089.1| hypothetical protein [Sporisorium scitamineum] emb|CDU21937.1| probable 40S ribosomal protein S25 [Sporisorium scitamineum] Length = 101 Score = 106 bits (265), Expect = 3e-27 Identities = 52/71 (73%), Positives = 62/71 (87%) Frame = -3 Query: 380 ANNAVMVDKPTYDKILKEVPTYKMISQSILIERMKINGSVARKAMRTLEDMGLIKRVVHH 201 A N V++D+PTYD+ILKEVPT+KMISQS LI+RMKINGS+AR A+R LE G IKR+VHH Sbjct: 30 AQNMVVLDRPTYDRILKEVPTFKMISQSTLIDRMKINGSLARVAIRHLEREGQIKRLVHH 89 Query: 200 HGQWVYTRATA 168 HGQ VYTRA+A Sbjct: 90 HGQLVYTRASA 100