BLASTX nr result
ID: Chrysanthemum21_contig00025900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00025900 (696 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI12151.1| Protein kinase, ATP binding site-containing prote... 60 9e-07 >gb|KVI12151.1| Protein kinase, ATP binding site-containing protein [Cynara cardunculus var. scolymus] Length = 726 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 692 QEDNLPFSLDDDSNVPHGSPSSVKRSPLRSTY 597 QEDNLPFSLDDDSN P GSPS V+RSPLRSTY Sbjct: 311 QEDNLPFSLDDDSNDPDGSPSYVRRSPLRSTY 342