BLASTX nr result
ID: Chrysanthemum21_contig00025610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00025610 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG13256.1| putative reverse transcriptase domain-containing ... 60 3e-07 dbj|GAV59615.1| hypothetical protein CFOL_v3_03146 [Cephalotus f... 54 5e-06 >gb|OTG13256.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1444 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -2 Query: 496 IELPGHYNVSATFNVADLSPYEGDSDDDLKSGVPLFQDGEDDA 368 I+LPGHYNVSATFNVADLSP+ + DD S F++GE+DA Sbjct: 1394 IDLPGHYNVSATFNVADLSPFVPEEDDPFDSRASPFEEGENDA 1436 >dbj|GAV59615.1| hypothetical protein CFOL_v3_03146 [Cephalotus follicularis] Length = 133 Score = 53.5 bits (127), Expect = 5e-06 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = -2 Query: 496 IELPGHYNVSATFNVADLSPYEGDSDDDLKSGVPLFQDGEDDAGASHATNNLVEY 332 IELPG YNVS TFNVA+LSPY DD+ S V L Q G DDA + A ++Y Sbjct: 73 IELPGEYNVSGTFNVANLSPY---YDDEADSRVNLSQGGVDDAKSESAVFGNMDY 124