BLASTX nr result
ID: Chrysanthemum21_contig00025300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00025300 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013569.1| vacuolar protein sorting-associated protein ... 59 1e-07 >ref|XP_022013569.1| vacuolar protein sorting-associated protein 9A-like [Helianthus annuus] gb|OTF96666.1| putative VPS9 domain-containing protein [Helianthus annuus] Length = 450 Score = 58.9 bits (141), Expect = 1e-07 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Frame = -1 Query: 370 EGSGKGFGVSSETP---VGGETVDSSEGDAQVD-VGVEGGRNDDVGASTPEY-VVGEVVS 206 +G +G GV+ P +GGE VD+ E D QV+ V VEG RND VGAS E V GEV S Sbjct: 383 DGKKEGSGVAEPPPEIVIGGEMVDAPENDVQVEAVRVEGDRNDGVGASAHESPVTGEVAS 442 Query: 205 LLEENVEK 182 EENVEK Sbjct: 443 QTEENVEK 450