BLASTX nr result
ID: Chrysanthemum21_contig00025139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00025139 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023753075.1| UDP-sugar pyrophosphorylase [Lactuca sativa]... 44 8e-08 ref|XP_022005770.1| UDP-sugar pyrophosphorylase-like [Helianthus... 44 1e-07 gb|KVI09311.1| UTP--glucose-1-phosphate uridylyltransferase [Cyn... 42 4e-07 ref|XP_020593011.1| UDP-sugar pyrophosphorylase [Phalaenopsis eq... 43 5e-07 ref|XP_020702530.1| UDP-sugar pyrophosphorylase-like [Dendrobium... 43 5e-07 gb|PKU68507.1| UDP-sugar pyrophosphorylase [Dendrobium catenatum] 43 5e-07 ref|XP_022026328.1| UDP-sugar pyrophosphorylase-like [Helianthus... 41 7e-07 ref|XP_021636590.1| UDP-sugar pyrophosphorylase-like [Hevea bras... 42 7e-07 ref|XP_022002494.1| UDP-sugar pyrophosphorylase-like [Helianthus... 41 7e-07 gb|PPD84086.1| hypothetical protein GOBAR_DD18972 [Gossypium bar... 42 8e-07 ref|XP_017618388.1| PREDICTED: UDP-sugar pyrophosphorylase-like ... 42 8e-07 ref|XP_016728387.1| PREDICTED: UDP-sugar pyrophosphorylase-like ... 42 8e-07 gb|PPS16191.1| hypothetical protein GOBAR_AA04384 [Gossypium bar... 42 8e-07 ref|XP_017618397.1| PREDICTED: UDP-sugar pyrophosphorylase-like ... 42 8e-07 ref|XP_016739671.1| PREDICTED: UDP-sugar pyrophosphorylase-like ... 42 8e-07 ref|XP_012464328.1| PREDICTED: UDP-sugar pyrophosphorylase-like ... 42 8e-07 ref|XP_012078333.1| UDP-sugar pyrophosphorylase [Jatropha curcas... 42 8e-07 ref|XP_021283972.1| UDP-sugar pyrophosphorylase [Herrania umbrat... 42 8e-07 gb|KHG06371.1| UDP-sugar pyrophospharylase [Gossypium arboreum] 42 8e-07 gb|OMO91211.1| UTP--glucose-1-phosphate uridylyltransferase [Cor... 42 9e-07 >ref|XP_023753075.1| UDP-sugar pyrophosphorylase [Lactuca sativa] gb|PLY93571.1| hypothetical protein LSAT_2X99200 [Lactuca sativa] Length = 627 Score = 44.3 bits (103), Expect(2) = 8e-08 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDPNNKY IQ Sbjct: 237 EKVACLADNDARLALDPNNKYKIQ 260 Score = 39.7 bits (91), Expect(2) = 8e-08 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDPIVFRLEET 257 K GLRWVLFFQDT+GL FK P + T Sbjct: 283 KDAGLRWVLFFQDTNGLLFKAIPAALGVSVT 313 >ref|XP_022005770.1| UDP-sugar pyrophosphorylase-like [Helianthus annuus] gb|OTF99042.1| putative UDP-sugar pyrophosphorylase [Helianthus annuus] Length = 627 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDPNNKY IQ Sbjct: 238 EKVACLADNDARLALDPNNKYRIQ 261 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDPIVFRLEET 257 K GLRWV+FFQDT+GL FK P + T Sbjct: 284 KDTGLRWVVFFQDTNGLLFKAIPAALGVSAT 314 >gb|KVI09311.1| UTP--glucose-1-phosphate uridylyltransferase [Cynara cardunculus var. scolymus] Length = 630 Score = 42.0 bits (97), Expect(2) = 4e-07 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP NKY IQ Sbjct: 238 EKVACLADNDARLALDPTNKYRIQ 261 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDPIVFRLEET 257 K GLRWVLFFQDT+GL FK P + T Sbjct: 284 KDAGLRWVLFFQDTNGLLFKAIPSALGVSAT 314 >ref|XP_020593011.1| UDP-sugar pyrophosphorylase [Phalaenopsis equestris] Length = 621 Score = 42.7 bits (99), Expect(2) = 5e-07 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDAR+ALDPN+KY+IQ Sbjct: 234 EKVACLDDNDARIALDPNDKYMIQ 257 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 283 GLRWVLFFQDTNGLLFKAIP 302 >ref|XP_020702530.1| UDP-sugar pyrophosphorylase-like [Dendrobium catenatum] Length = 602 Score = 42.7 bits (99), Expect(2) = 5e-07 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDAR+ALDPN+KY+IQ Sbjct: 214 EKVACLDDNDARIALDPNDKYMIQ 237 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 263 GLRWVLFFQDTNGLLFKAIP 282 >gb|PKU68507.1| UDP-sugar pyrophosphorylase [Dendrobium catenatum] Length = 516 Score = 42.7 bits (99), Expect(2) = 5e-07 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDAR+ALDPN+KY+IQ Sbjct: 128 EKVACLDDNDARIALDPNDKYMIQ 151 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 177 GLRWVLFFQDTNGLLFKAIP 196 >ref|XP_022026328.1| UDP-sugar pyrophosphorylase-like [Helianthus annuus] gb|OTG35318.1| putative UDP-sugar pyrophosphorylase [Helianthus annuus] Length = 627 Score = 40.8 bits (94), Expect(2) = 7e-07 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLA+DP NKY IQ Sbjct: 238 EKVACLADNDARLAVDPKNKYRIQ 261 Score = 40.0 bits (92), Expect(2) = 7e-07 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDPIVFRLEET 257 K GLRWVLFFQDT+GL FK P + T Sbjct: 284 KDAGLRWVLFFQDTNGLLFKAIPAALGVSAT 314 >ref|XP_021636590.1| UDP-sugar pyrophosphorylase-like [Hevea brasiliensis] Length = 622 Score = 41.6 bits (96), Expect(2) = 7e-07 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP NKY IQ Sbjct: 233 EKVACLEDNDARLALDPQNKYRIQ 256 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDP 233 K GLRWVLFFQDT+GL FK P Sbjct: 279 KDAGLRWVLFFQDTNGLLFKAIP 301 >ref|XP_022002494.1| UDP-sugar pyrophosphorylase-like [Helianthus annuus] Length = 146 Score = 40.8 bits (94), Expect(2) = 7e-07 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLA+DP NKY IQ Sbjct: 33 EKVACLADNDARLAVDPKNKYRIQ 56 Score = 40.0 bits (92), Expect(2) = 7e-07 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +3 Query: 165 KVVGLRWVLFFQDTDGLFFKVDPIVFRLEET 257 K GLRWVLFFQDT+GL FK P + T Sbjct: 79 KDAGLRWVLFFQDTNGLLFKAIPAALGVSAT 109 >gb|PPD84086.1| hypothetical protein GOBAR_DD18972 [Gossypium barbadense] Length = 653 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 262 EKVACLDDNDARLALDPHNKYQIQ 285 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 311 GLRWVLFFQDTNGLLFKAIP 330 >ref|XP_017618388.1| PREDICTED: UDP-sugar pyrophosphorylase-like isoform X1 [Gossypium arboreum] Length = 642 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 251 EKVACLDDNDARLALDPHNKYQIQ 274 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 300 GLRWVLFFQDTNGLLFKAIP 319 >ref|XP_016728387.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium hirsutum] Length = 642 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 251 EKVACLDDNDARLALDPHNKYQIQ 274 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 300 GLRWVLFFQDTNGLLFKAIP 319 >gb|PPS16191.1| hypothetical protein GOBAR_AA04384 [Gossypium barbadense] Length = 627 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 236 EKVACLDDNDARLALDPHNKYQIQ 259 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 285 GLRWVLFFQDTNGLLFKAIP 304 >ref|XP_017618397.1| PREDICTED: UDP-sugar pyrophosphorylase-like isoform X2 [Gossypium arboreum] Length = 627 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 236 EKVACLDDNDARLALDPHNKYQIQ 259 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 285 GLRWVLFFQDTNGLLFKAIP 304 >ref|XP_016739671.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium hirsutum] ref|XP_016739672.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium hirsutum] ref|XP_016739673.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium hirsutum] Length = 627 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 236 EKVACLDDNDARLALDPHNKYQIQ 259 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 285 GLRWVLFFQDTNGLLFKAIP 304 >ref|XP_012464328.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium raimondii] ref|XP_012464329.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium raimondii] ref|XP_012464330.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Gossypium raimondii] gb|KJB80649.1| hypothetical protein B456_013G108400 [Gossypium raimondii] Length = 627 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 236 EKVACLDDNDARLALDPHNKYQIQ 259 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 285 GLRWVLFFQDTNGLLFKAIP 304 >ref|XP_012078333.1| UDP-sugar pyrophosphorylase [Jatropha curcas] gb|KDP32870.1| hypothetical protein JCGZ_12162 [Jatropha curcas] Length = 622 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 233 EKVACLEDNDARLALDPHNKYRIQ 256 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 282 GLRWVLFFQDTNGLLFKAIP 301 >ref|XP_021283972.1| UDP-sugar pyrophosphorylase [Herrania umbratica] Length = 621 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 232 EKVACLDDNDARLALDPHNKYKIQ 255 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 281 GLRWVLFFQDTNGLLFKAIP 300 >gb|KHG06371.1| UDP-sugar pyrophospharylase [Gossypium arboreum] Length = 603 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 251 EKVACLDDNDARLALDPHNKYQIQ 274 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 300 GLRWVLFFQDTNGLLFKAIP 319 >gb|OMO91211.1| UTP--glucose-1-phosphate uridylyltransferase [Corchorus capsularis] Length = 411 Score = 42.0 bits (97), Expect(2) = 9e-07 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 92 EKVTCFFDNDARLALDPNNKYIIQ 163 EKV C DNDARLALDP+NKY IQ Sbjct: 239 EKVACLDDNDARLALDPHNKYKIQ 262 Score = 38.5 bits (88), Expect(2) = 9e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 174 GLRWVLFFQDTDGLFFKVDP 233 GLRWVLFFQDT+GL FK P Sbjct: 288 GLRWVLFFQDTNGLLFKAIP 307