BLASTX nr result
ID: Chrysanthemum21_contig00025096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00025096 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016166709.1| cyclin-dependent kinase C-2-like [Arachis ip... 62 8e-14 ref|XP_014522149.1| cyclin-dependent kinase C-2 [Vigna radiata v... 57 2e-12 ref|XP_017439681.1| PREDICTED: cyclin-dependent kinase C-2-like ... 57 2e-12 ref|XP_007146195.1| hypothetical protein PHAVU_006G020500g [Phas... 57 2e-12 ref|XP_020231471.1| cyclin-dependent kinase C-2-like isoform X1 ... 57 2e-12 dbj|BAT80911.1| hypothetical protein VIGAN_03053700 [Vigna angul... 57 2e-12 ref|XP_014505268.1| cyclin-dependent kinase C-2 [Vigna radiata v... 57 2e-12 gb|KHN16213.1| Cyclin-dependent kinase C-1 [Glycine soja] 57 2e-12 ref|XP_007141548.1| hypothetical protein PHAVU_008G205500g [Phas... 57 2e-12 ref|XP_003555471.1| PREDICTED: cyclin-dependent kinase C-2-like ... 57 2e-12 ref|XP_004489978.1| PREDICTED: cyclin-dependent kinase C-2 [Cice... 57 2e-12 ref|XP_015973469.1| cyclin-dependent kinase C-2 [Arachis duranen... 57 2e-12 gb|KHN26013.1| Cyclin-dependent kinase C-2 [Glycine soja] 57 2e-12 ref|XP_006595794.1| PREDICTED: cyclin-dependent kinase C-2-like ... 57 2e-12 ref|XP_003519496.1| PREDICTED: cyclin-dependent kinase C-2-like ... 57 2e-12 ref|XP_020231473.1| cyclin-dependent kinase C-2-like isoform X2 ... 57 2e-12 ref|XP_020210628.1| cyclin-dependent kinase C-2-like [Cajanus ca... 57 2e-12 ref|XP_013459463.1| cyclin-dependent kinase C-2 [Medicago trunca... 57 2e-12 emb|CAA65979.1| cdc2MsC [Medicago sativa] 57 2e-12 ref|XP_017428504.1| PREDICTED: cyclin-dependent kinase C-2-like ... 57 2e-12 >ref|XP_016166709.1| cyclin-dependent kinase C-2-like [Arachis ipaensis] Length = 361 Score = 61.6 bits (148), Expect(2) = 8e-14 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LADC G +FT PQI+CYM Sbjct: 103 DGNKYKGG-VYMVFEYMDHDLTGLADCPGMRFTVPQIKCYM 142 Score = 42.7 bits (99), Expect(2) = 8e-14 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 140 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 167 >ref|XP_014522149.1| cyclin-dependent kinase C-2 [Vigna radiata var. radiata] Length = 522 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_017439681.1| PREDICTED: cyclin-dependent kinase C-2-like [Vigna angularis] dbj|BAT88713.1| hypothetical protein VIGAN_05229500 [Vigna angularis var. angularis] Length = 521 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_007146195.1| hypothetical protein PHAVU_006G020500g [Phaseolus vulgaris] gb|ESW18189.1| hypothetical protein PHAVU_006G020500g [Phaseolus vulgaris] Length = 521 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_020231471.1| cyclin-dependent kinase C-2-like isoform X1 [Cajanus cajan] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 103 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 142 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 140 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 167 >dbj|BAT80911.1| hypothetical protein VIGAN_03053700 [Vigna angularis var. angularis] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYRGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_014505268.1| cyclin-dependent kinase C-2 [Vigna radiata var. radiata] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYRGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >gb|KHN16213.1| Cyclin-dependent kinase C-1 [Glycine soja] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_007141548.1| hypothetical protein PHAVU_008G205500g [Phaseolus vulgaris] gb|ESW13542.1| hypothetical protein PHAVU_008G205500g [Phaseolus vulgaris] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_003555471.1| PREDICTED: cyclin-dependent kinase C-2-like isoform X1 [Glycine max] gb|KRG89779.1| hypothetical protein GLYMA_20G048000 [Glycine max] Length = 520 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_004489978.1| PREDICTED: cyclin-dependent kinase C-2 [Cicer arietinum] Length = 519 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_015973469.1| cyclin-dependent kinase C-2 [Arachis duranensis] ref|XP_016166475.1| cyclin-dependent kinase C-2 [Arachis ipaensis] Length = 516 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >gb|KHN26013.1| Cyclin-dependent kinase C-2 [Glycine soja] Length = 516 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_006595794.1| PREDICTED: cyclin-dependent kinase C-2-like [Glycine max] gb|KRH14656.1| hypothetical protein GLYMA_14G039900 [Glycine max] Length = 516 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_003519496.1| PREDICTED: cyclin-dependent kinase C-2-like [Glycine max] gb|KRH73489.1| hypothetical protein GLYMA_02G276000 [Glycine max] Length = 516 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_020231473.1| cyclin-dependent kinase C-2-like isoform X2 [Cajanus cajan] Length = 515 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 98 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 137 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 135 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 162 >ref|XP_020210628.1| cyclin-dependent kinase C-2-like [Cajanus cajan] Length = 513 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_013459463.1| cyclin-dependent kinase C-2 [Medicago truncatula] gb|KEH33494.1| cyclin-dependent kinase C-2 [Medicago truncatula] Length = 509 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >emb|CAA65979.1| cdc2MsC [Medicago sativa] Length = 509 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYKGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169 >ref|XP_017428504.1| PREDICTED: cyclin-dependent kinase C-2-like [Vigna angularis] Length = 499 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 408 DGHRYTGGGTYMVFEYVEHGLT*LADCTGRKFTAPQIECYM 286 DG++Y GG YMVFEY++H LT LAD G +FT PQI+CYM Sbjct: 105 DGNKYRGG-IYMVFEYMDHDLTGLADRPGMRFTVPQIKCYM 144 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 287 CYLRQLLTEHHYFHVNQVLDKDLKSNRL 204 CY+RQLLT HY HVNQVL +D+K + L Sbjct: 142 CYMRQLLTGLHYCHVNQVLHRDIKGSNL 169