BLASTX nr result
ID: Chrysanthemum21_contig00024841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024841 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022038307.1| putative F-box protein At1g32420 [Helianthus... 62 7e-09 ref|XP_022039195.1| putative F-box protein At1g32420 [Helianthus... 60 3e-08 ref|XP_021998659.1| F-box protein At5g65850-like [Helianthus ann... 60 5e-08 ref|XP_021980095.1| F-box protein At1g47340-like [Helianthus ann... 60 6e-08 ref|XP_022036627.1| F-box protein At5g65850-like [Helianthus ann... 59 8e-08 ref|XP_021998692.1| putative F-box protein At1g50870 [Helianthus... 59 1e-07 ref|XP_022006812.1| F-box protein At5g65850-like [Helianthus ann... 59 1e-07 gb|OTG25318.1| putative F-box domain-containing protein [Heliant... 59 1e-07 gb|OTG25328.1| putative F-box domain-containing protein [Heliant... 58 2e-07 ref|XP_022038305.1| putative F-box protein At1g47790 [Helianthus... 58 2e-07 ref|XP_022031718.1| F-box protein At1g30790-like [Helianthus ann... 57 3e-07 ref|XP_022021011.1| putative F-box protein At1g47790 isoform X2 ... 57 4e-07 ref|XP_022031719.1| putative F-box protein At1g50870 [Helianthus... 57 4e-07 gb|OTG27060.1| putative F-box domain-containing protein [Heliant... 57 4e-07 ref|XP_022021004.1| putative F-box protein At1g47790 isoform X1 ... 57 4e-07 ref|XP_022031726.1| putative F-box protein At1g50870 [Helianthus... 57 4e-07 ref|XP_021998710.1| putative F-box protein At1g32420 [Helianthus... 56 1e-06 ref|XP_021999665.1| putative F-box protein At1g53370 [Helianthus... 55 2e-06 ref|XP_022038296.1| F-box protein At1g30790-like [Helianthus ann... 55 2e-06 ref|XP_022007141.1| putative F-box protein At1g32420 [Helianthus... 54 5e-06 >ref|XP_022038307.1| putative F-box protein At1g32420 [Helianthus annuus] ref|XP_022038308.1| putative F-box protein At1g32420 [Helianthus annuus] gb|OTG25329.1| putative F-box domain-containing protein [Helianthus annuus] Length = 400 Score = 62.4 bits (150), Expect = 7e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K+NG LG+L HDRV ESNEM IW+L+DYE+RVWV Sbjct: 271 LIKINGLLGILSHDRVEESNEMHIWILQDYEKRVWV 306 >ref|XP_022039195.1| putative F-box protein At1g32420 [Helianthus annuus] gb|OTG26230.1| putative F-box domain-containing protein [Helianthus annuus] Length = 392 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 F++KVNG +GV+CHD V+E+NE+ IW L+DYE RVWV Sbjct: 273 FMIKVNGCIGVVCHDLVLENNEIHIWTLQDYENRVWV 309 >ref|XP_021998659.1| F-box protein At5g65850-like [Helianthus annuus] gb|OTG34639.1| putative F-box domain-containing protein [Helianthus annuus] Length = 414 Score = 60.1 bits (144), Expect = 5e-08 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 ++ ++GFLGV+CHDRVVES M IW+L+DYE+RVWV Sbjct: 295 IISISGFLGVVCHDRVVESKGMRIWVLQDYEKRVWV 330 >ref|XP_021980095.1| F-box protein At1g47340-like [Helianthus annuus] gb|OTG15050.1| putative F-box domain-containing protein [Helianthus annuus] Length = 383 Score = 59.7 bits (143), Expect = 6e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 ++K+NG +GV+CHD VVESN+M IW+L DYE RVWV Sbjct: 264 ILKINGRVGVVCHDHVVESNKMHIWILYDYETRVWV 299 >ref|XP_022036627.1| F-box protein At5g65850-like [Helianthus annuus] gb|OTG25330.1| putative F-box domain-containing protein [Helianthus annuus] Length = 397 Score = 59.3 bits (142), Expect = 8e-08 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -3 Query: 106 MKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +K+NG LG++ HDRV ESNEM IW+L+DYE+RVW+ Sbjct: 269 IKINGLLGIVSHDRVEESNEMHIWILQDYEKRVWI 303 >ref|XP_021998692.1| putative F-box protein At1g50870 [Helianthus annuus] gb|OTG34641.1| putative F-box domain-containing protein [Helianthus annuus] Length = 406 Score = 58.9 bits (141), Expect = 1e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 106 MKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +K+NG +GV+CHD V+E NEM IW+L+DYE RVWV Sbjct: 288 IKINGCIGVVCHDLVLEKNEMHIWILQDYENRVWV 322 >ref|XP_022006812.1| F-box protein At5g65850-like [Helianthus annuus] gb|OTG34589.1| putative F-box domain-containing protein [Helianthus annuus] Length = 408 Score = 58.9 bits (141), Expect = 1e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K+NG +GV+CHD V+ SNEM IW L+DYE RVWV Sbjct: 290 LIKINGCIGVVCHDNVLLSNEMHIWRLQDYENRVWV 325 >gb|OTG25318.1| putative F-box domain-containing protein [Helianthus annuus] Length = 449 Score = 58.9 bits (141), Expect = 1e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 FLMK+NG+LGV+CH+ V NEMDIW+L DY+ R+W+ Sbjct: 327 FLMKINGYLGVMCHNPVAGLNEMDIWILVDYKNRLWL 363 >gb|OTG25328.1| putative F-box domain-containing protein [Helianthus annuus] Length = 356 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K NG LG++CHD V E N+M IW+L+DYE+RVWV Sbjct: 264 LIKTNGLLGIVCHDLVEEGNKMHIWILQDYEKRVWV 299 >ref|XP_022038305.1| putative F-box protein At1g47790 [Helianthus annuus] Length = 388 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K NG LG++CHD V E N+M IW+L+DYE+RVWV Sbjct: 264 LIKTNGLLGIVCHDLVEEGNKMHIWILQDYEKRVWV 299 >ref|XP_022031718.1| F-box protein At1g30790-like [Helianthus annuus] Length = 269 Score = 57.4 bits (137), Expect = 3e-07 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +++K+NG +GV+C+D V E+NEM IW+L+DYE RVWV Sbjct: 148 YIIKLNGCIGVVCYDSVAENNEMYIWILQDYENRVWV 184 >ref|XP_022021011.1| putative F-box protein At1g47790 isoform X2 [Helianthus annuus] Length = 389 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/36 (61%), Positives = 33/36 (91%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K++G +GV+ HDRVVE+NE+++W+L+DYE RVWV Sbjct: 271 LIKISGCIGVVSHDRVVENNEINLWILQDYENRVWV 306 >ref|XP_022031719.1| putative F-box protein At1g50870 [Helianthus annuus] gb|OTG27052.1| putative F-box domain-containing protein [Helianthus annuus] Length = 398 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +++K+NG +GV+C+D V E+NEM IW+L+DYE RVWV Sbjct: 277 YIIKLNGCIGVVCYDSVAENNEMYIWILQDYENRVWV 313 >gb|OTG27060.1| putative F-box domain-containing protein [Helianthus annuus] Length = 398 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +++K+NG +GV+C+D V E+NEM IW+L+DYE RVWV Sbjct: 277 YIIKLNGCIGVVCYDSVAENNEMYIWILQDYENRVWV 313 >ref|XP_022021004.1| putative F-box protein At1g47790 isoform X1 [Helianthus annuus] gb|OTG34569.1| putative F-box domain-containing protein [Helianthus annuus] Length = 417 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/36 (61%), Positives = 33/36 (91%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 L+K++G +GV+ HDRVVE+NE+++W+L+DYE RVWV Sbjct: 271 LIKISGCIGVVSHDRVVENNEINLWILQDYENRVWV 306 >ref|XP_022031726.1| putative F-box protein At1g50870 [Helianthus annuus] Length = 436 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 +++K+NG +GV+C+D V E+NEM IW+L+DYE RVWV Sbjct: 315 YIIKLNGCIGVVCYDSVAENNEMYIWILQDYENRVWV 351 >ref|XP_021998710.1| putative F-box protein At1g32420 [Helianthus annuus] Length = 367 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 + K+NG++GV+CH V E+NEM IW+L+DYE RVWV Sbjct: 261 ITKINGYIGVVCHYCVGENNEMHIWILQDYENRVWV 296 >ref|XP_021999665.1| putative F-box protein At1g53370 [Helianthus annuus] gb|OTG34803.1| putative F-box domain-containing protein [Helianthus annuus] Length = 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 ++K+NG +GV+C D VVESN+M IW+L D+E RVWV Sbjct: 264 ILKINGCVGVVCRDHVVESNKMHIWILYDFETRVWV 299 >ref|XP_022038296.1| F-box protein At1g30790-like [Helianthus annuus] gb|OTG25320.1| putative F-box domain-containing protein [Helianthus annuus] Length = 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -3 Query: 112 FLMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 FLMK+NG+LGV+C + V +EMDIW+L DYE R+W+ Sbjct: 341 FLMKINGYLGVMCRNPVAGRDEMDIWILLDYEYRLWL 377 >ref|XP_022007141.1| putative F-box protein At1g32420 [Helianthus annuus] Length = 402 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -3 Query: 109 LMKVNGFLGVLCHDRVVESNEMDIWMLRDYEERVWV 2 ++KV+G + V CHDRVV++N+M IW+L+DYE VWV Sbjct: 283 IIKVSGCVAVACHDRVVDTNKMHIWILQDYENHVWV 318