BLASTX nr result
ID: Chrysanthemum21_contig00024820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024820 (1014 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH96359.1| hypothetical protein Ccrd_001565 [Cynara carduncu... 60 5e-07 >gb|KVH96359.1| hypothetical protein Ccrd_001565 [Cynara cardunculus var. scolymus] Length = 216 Score = 60.5 bits (145), Expect = 5e-07 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 4/101 (3%) Frame = -1 Query: 978 GKKDYVLNLATKASKILFWISFKHSPCYHHCRFTRCFHHLHPHFTSKPQTLPHTS*NNGP 799 G + V ++TKA +I F +SFK +P YHH RFT FHHLH S QT P + Sbjct: 110 GMEYKVTRVSTKAREIPFRVSFKCTPRYHHRRFTGRFHHLHRRSCSATQTPPQAPEKSAD 169 Query: 798 KSKSSRQCVD----ADFDNRSNRPQQDSDYAYDEHTQELNN 688 +++ + V+ + DNR N P+++S+ + H N Sbjct: 170 GGETTFENVENALKQESDNRKNAPKRESENGGEGHKHAAAN 210