BLASTX nr result
ID: Chrysanthemum21_contig00024563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024563 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016514801.1| PREDICTED: zinc finger BED domain-containing... 59 2e-08 dbj|BAT75705.1| hypothetical protein VIGAN_01361400 [Vigna angul... 56 7e-08 dbj|BAT89627.1| hypothetical protein VIGAN_06062500, partial [Vi... 57 1e-07 ref|XP_016498732.1| PREDICTED: zinc finger BED domain-containing... 59 2e-07 ref|XP_016498731.1| PREDICTED: zinc finger BED domain-containing... 59 2e-07 ref|XP_016498730.1| PREDICTED: zinc finger BED domain-containing... 59 2e-07 ref|XP_016498727.1| PREDICTED: zinc finger BED domain-containing... 59 2e-07 ref|XP_016498726.1| PREDICTED: zinc finger BED domain-containing... 59 2e-07 ref|XP_019252839.1| PREDICTED: zinc finger BED domain-containing... 58 3e-07 ref|XP_017409089.1| PREDICTED: uncharacterized protein LOC108321... 57 5e-07 ref|XP_017438300.1| PREDICTED: zinc finger BED domain-containing... 56 1e-06 gb|POE73870.1| putative ac transposase [Quercus suber] 54 1e-06 ref|XP_009769481.1| PREDICTED: zinc finger BED domain-containing... 55 1e-06 gb|POE81288.1| hypothetical protein CFP56_48446 [Quercus suber] 54 2e-06 ref|XP_016446021.1| PREDICTED: zinc finger BED domain-containing... 54 2e-06 ref|XP_009767674.1| PREDICTED: zinc finger BED domain-containing... 54 2e-06 gb|POE81289.1| putative ac transposase [Quercus suber] 54 2e-06 ref|XP_016498678.1| PREDICTED: zinc finger BED domain-containing... 54 3e-06 ref|XP_023875653.1| zinc finger BED domain-containing protein DA... 54 3e-06 gb|OTG27740.1| putative HAT dimerization domain, Ribonuclease H-... 52 4e-06 >ref|XP_016514801.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, partial [Nicotiana tabacum] Length = 130 Score = 58.5 bits (140), Expect = 2e-08 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 80 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 115 >dbj|BAT75705.1| hypothetical protein VIGAN_01361400 [Vigna angularis var. angularis] Length = 90 Score = 56.2 bits (134), Expect = 7e-08 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP+TLEALMC QDWLWS I+GS Sbjct: 30 HRSRLHPDTLEALMCVQDWLWSDIQGS 56 >dbj|BAT89627.1| hypothetical protein VIGAN_06062500, partial [Vigna angularis var. angularis] Length = 161 Score = 57.0 bits (136), Expect = 1e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHPNTLE+LMC QDWLWS I+GS Sbjct: 115 HRSRLHPNTLESLMCVQDWLWSDIQGS 141 >ref|XP_016498732.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X5 [Nicotiana tabacum] Length = 315 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 265 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 300 >ref|XP_016498731.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X4 [Nicotiana tabacum] Length = 323 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 273 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 308 >ref|XP_016498730.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X3 [Nicotiana tabacum] Length = 334 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 284 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 319 >ref|XP_016498727.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Nicotiana tabacum] ref|XP_016498728.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Nicotiana tabacum] ref|XP_016498729.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Nicotiana tabacum] Length = 348 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 298 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 333 >ref|XP_016498726.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Nicotiana tabacum] Length = 359 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS+ C Sbjct: 309 HRSRLHPTTLEALMCARTWLWNEINGSCSSIDRVSC 344 >ref|XP_019252839.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana attenuata] Length = 424 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GSCS C Sbjct: 374 HRSRLHPTTLEALMCARTWLWNEINGSCSRIDRVSC 409 >ref|XP_017409089.1| PREDICTED: uncharacterized protein LOC108321747 [Vigna angularis] Length = 266 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHPNTLE+LMC QDWLWS I+GS Sbjct: 172 HRSRLHPNTLESLMCVQDWLWSDIQGS 198 >ref|XP_017438300.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like [Vigna angularis] Length = 447 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP+TLEALMC QDWLWS I+GS Sbjct: 387 HRSRLHPDTLEALMCVQDWLWSDIQGS 413 >gb|POE73870.1| putative ac transposase [Quercus suber] Length = 152 Score = 54.3 bits (129), Expect = 1e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP T+EA+MCAQ+WLWS+I GS Sbjct: 88 HRSRLHPKTIEAMMCAQNWLWSEINGS 114 >ref|XP_009769481.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, partial [Nicotiana sylvestris] Length = 181 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW++I GS S+ C Sbjct: 134 HRSRLHPTTLEALMCARTWLWNEINGSSSSIDRVSC 169 >gb|POE81288.1| hypothetical protein CFP56_48446 [Quercus suber] Length = 164 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP T+EA+MCAQ+WLWS+I GS Sbjct: 107 HRSRLHPKTIEAMMCAQNWLWSEINGS 133 >ref|XP_016446021.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tabacum] ref|XP_016446026.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tabacum] ref|XP_016446032.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tabacum] ref|XP_016446038.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tabacum] ref|XP_016446044.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tabacum] Length = 170 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW +I G ST C Sbjct: 120 HRSRLHPTTLEALMCARTWLWKEINGLASTVDKVSC 155 >ref|XP_009767674.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] ref|XP_009767675.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] ref|XP_009767676.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] ref|XP_009767677.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] ref|XP_009767678.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] Length = 170 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALMCA+ WLW +I G ST C Sbjct: 120 HRSRLHPTTLEALMCARTWLWKEINGLASTVDKVSC 155 >gb|POE81289.1| putative ac transposase [Quercus suber] Length = 173 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP T+EA+MCAQ+WLWS+I GS Sbjct: 116 HRSRLHPKTIEAMMCAQNWLWSEINGS 142 >ref|XP_016498678.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Nicotiana tabacum] Length = 221 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP TLEALM A+ WLW++I GSCS+ C Sbjct: 171 HRSRLHPTTLEALMYARTWLWNEINGSCSSIDRVSC 206 >ref|XP_023875653.1| zinc finger BED domain-containing protein DAYSLEEPER-like [Quercus suber] Length = 231 Score = 54.3 bits (129), Expect = 3e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGS 287 HRSRLHP T+EA+MCAQ+WLWS+I GS Sbjct: 167 HRSRLHPKTIEAMMCAQNWLWSEINGS 193 >gb|OTG27740.1| putative HAT dimerization domain, Ribonuclease H-like domain protein [Helianthus annuus] Length = 86 Score = 51.6 bits (122), Expect = 4e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -1 Query: 367 HRSRLHPNTLEALMCAQDWLWSQIKGSCSTGHATCC 260 HRSRLHP+TLEALMCAQ WL ++I+ +CS C Sbjct: 33 HRSRLHPSTLEALMCAQSWLLNEIRETCSKETEAYC 68