BLASTX nr result
ID: Chrysanthemum21_contig00024492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024492 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023761833.1| pyridoxal 5'-phosphate synthase-like subunit... 74 1e-12 gb|KVH92969.1| Aldolase-type TIM barrel [Cynara cardunculus var.... 71 1e-11 ref|XP_022006119.1| pyridoxal 5'-phosphate synthase-like subunit... 65 9e-10 ref|XP_017231761.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 60 1e-07 gb|KZN06727.1| hypothetical protein DCAR_007564 [Daucus carota s... 60 1e-07 ref|XP_011080804.1| pyridoxal 5'-phosphate synthase-like subunit... 59 3e-07 ref|XP_012852815.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 58 4e-07 gb|PHT88759.1| putative pyridoxal 5'-phosphate synthase subunit ... 56 2e-06 gb|PHT47230.1| Pyridoxal 5'-phosphate synthase-like subunit PDX1... 56 2e-06 ref|XP_016553694.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_015067382.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_004235714.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_019240125.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_016444576.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_009796117.1| PREDICTED: probable pyridoxal biosynthesis p... 56 2e-06 ref|XP_009591291.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 56 2e-06 ref|XP_008228527.1| PREDICTED: pyridoxal 5'-phosphate synthase-l... 54 8e-06 ref|XP_007215728.1| pyridoxal 5'-phosphate synthase-like subunit... 54 8e-06 >ref|XP_023761833.1| pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Lactuca sativa] gb|PLY87164.1| hypothetical protein LSAT_5X130361 [Lactuca sativa] Length = 310 Score = 73.6 bits (179), Expect = 1e-12 Identities = 40/69 (57%), Positives = 50/69 (72%) Frame = -1 Query: 423 ECLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNIDE 244 +C DPY++VRAIV+AVRNYNDA ILAKVSSGL+D AT+ +DAMTG+N+D+ Sbjct: 255 DCSDPYKSVRAIVQAVRNYNDAHILAKVSSGLNDSIATT----------SDAMTGLNLDD 304 Query: 243 NENAEGSSY 217 N G SY Sbjct: 305 N---TGGSY 310 >gb|KVH92969.1| Aldolase-type TIM barrel [Cynara cardunculus var. scolymus] Length = 315 Score = 70.9 bits (172), Expect = 1e-11 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = -1 Query: 414 DPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNIDEN 241 DPY+ VR IV+AVRNYNDA +LAK SSGL+D TS +ELNDA+TG+N+DEN Sbjct: 259 DPYKRVRGIVQAVRNYNDAHMLAKASSGLNDAIITSS------SELNDAITGLNLDEN 310 >ref|XP_022006119.1| pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Helianthus annuus] gb|OTF99385.1| putative pyridoxine biosynthesis 1.2 [Helianthus annuus] Length = 307 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 417 LDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNID 247 +DPY++VRAIV+AVRNYNDA ILAKVSSGL+D+ A+S +E+ D MT N+D Sbjct: 257 VDPYKSVRAIVQAVRNYNDAHILAKVSSGLNDVVASS-------SEVADVMTSFNLD 306 >ref|XP_017231761.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Daucus carota subsp. sativus] Length = 321 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNIDEN 241 C DPY+ VRAIV+AVRNY+D R+LA+VSSG ++ + ++ N V + T N+DEN Sbjct: 254 CADPYKKVRAIVQAVRNYSDPRVLAEVSSGFNEAMSRFNLDENSVEQFG---TRFNLDEN 310 >gb|KZN06727.1| hypothetical protein DCAR_007564 [Daucus carota subsp. sativus] Length = 496 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNIDEN 241 C DPY+ VRAIV+AVRNY+D R+LA+VSSG ++ + ++ N V + T N+DEN Sbjct: 429 CADPYKKVRAIVQAVRNYSDPRVLAEVSSGFNEAMSRFNLDENSVEQFG---TRFNLDEN 485 >ref|XP_011080804.1| pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Sesamum indicum] Length = 305 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -1 Query: 423 ECLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 +CLDPY+ VRAIV+AVRNYND LA+ SSGL D A +G+ LNE Sbjct: 251 DCLDPYKKVRAIVQAVRNYNDPMELAEASSGLED--AMAGLNLNE 293 >ref|XP_012852815.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Erythranthe guttata] gb|EYU24698.1| hypothetical protein MIMGU_mgv1a027113mg [Erythranthe guttata] Length = 305 Score = 58.2 bits (139), Expect = 4e-07 Identities = 32/68 (47%), Positives = 39/68 (57%) Frame = -1 Query: 423 ECLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNEVNELNDAMTGVNIDE 244 +CLDPY+ VRAIV+AVRNYND LA+ SSG L +AM G+N+DE Sbjct: 253 DCLDPYKKVRAIVQAVRNYNDPLELAQASSG-----------------LEEAMAGLNVDE 295 Query: 243 NENAEGSS 220 A G S Sbjct: 296 QFGAAGGS 303 >gb|PHT88759.1| putative pyridoxal 5'-phosphate synthase subunit PDX1 [Capsicum annuum] Length = 305 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLDE--AMGGLNLNE 293 >gb|PHT47230.1| Pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Capsicum baccatum] Length = 305 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLDE--AMGGLNLNE 293 >ref|XP_016553694.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Capsicum annuum] ref|XP_016562742.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Capsicum annuum] Length = 305 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLDE--AMGGLNLNE 293 >ref|XP_015067382.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Solanum pennellii] Length = 305 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_004235714.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Solanum lycopersicum] Length = 305 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_019240125.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Nicotiana attenuata] gb|OIT20471.1| pyridoxal 5'-phosphate synthase-like subunit pdx1.2 [Nicotiana attenuata] Length = 306 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_016444576.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Nicotiana tabacum] Length = 306 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_009796117.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Nicotiana sylvestris] ref|XP_016501321.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Nicotiana tabacum] Length = 306 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_009591291.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Nicotiana tomentosiformis] Length = 306 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VRAIV+AVRNYND ILA SSGL + A G+ LNE Sbjct: 252 CSDPYKKVRAIVQAVRNYNDPHILAAASSGLEE--AMGGLNLNE 293 >ref|XP_008228527.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Prunus mume] Length = 308 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VR IVEAVRNYND +L + SSGLS G +G++L E Sbjct: 254 CSDPYKRVRGIVEAVRNYNDPHVLVETSSGLS--GLMAGLDLGE 295 >ref|XP_007215728.1| pyridoxal 5'-phosphate synthase-like subunit PDX1.2 [Prunus persica] gb|ONI15929.1| hypothetical protein PRUPE_3G069500 [Prunus persica] Length = 308 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 420 CLDPYRNVRAIVEAVRNYNDARILAKVSSGLSDMGATSGMELNE 289 C DPY+ VR IVEAVRNYND +L + SSGLS G +G++L E Sbjct: 254 CSDPYKRVRGIVEAVRNYNDPHVLVETSSGLS--GLMAGLDLGE 295