BLASTX nr result
ID: Chrysanthemum21_contig00024363
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024363 (766 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073248.1| uncharacterized protein LOC105158260 [Sesamu... 63 4e-09 gb|KJB57121.1| hypothetical protein B456_009G149300 [Gossypium r... 60 2e-08 ref|XP_019169497.1| PREDICTED: uncharacterized protein LOC109165... 62 2e-08 ref|XP_023891294.1| uncharacterized protein LOC112003339 [Quercu... 60 2e-08 ref|XP_012444343.1| PREDICTED: uncharacterized protein LOC105768... 60 2e-08 ref|XP_017607195.1| PREDICTED: uncharacterized protein LOC108453... 60 3e-08 gb|KVI06104.1| hypothetical protein Ccrd_015555 [Cynara carduncu... 59 3e-08 ref|XP_015071194.1| PREDICTED: uncharacterized protein LOC107015... 60 4e-08 ref|XP_016902643.1| PREDICTED: uncharacterized protein LOC107991... 60 5e-08 gb|KGN45194.1| hypothetical protein Csa_7G430780 [Cucumis sativus] 60 5e-08 gb|PHT88525.1| hypothetical protein T459_10631 [Capsicum annuum]... 60 5e-08 emb|CDO98267.1| unnamed protein product [Coffea canephora] 60 5e-08 gb|PHT47513.1| hypothetical protein CQW23_11721 [Capsicum baccatum] 60 5e-08 ref|XP_022954157.1| uncharacterized protein LOC111456503 [Cucurb... 61 7e-08 gb|PIN18198.1| hypothetical protein CDL12_09136 [Handroanthus im... 59 9e-08 ref|XP_023548962.1| uncharacterized protein LOC111807461 [Cucurb... 59 1e-07 gb|OMO65950.1| hypothetical protein COLO4_30895 [Corchorus olito... 60 1e-07 ref|XP_012856221.1| PREDICTED: uncharacterized protein LOC105975... 59 1e-07 ref|XP_011623851.1| uncharacterized protein LOC105420743 [Ambore... 57 3e-07 ref|XP_021295158.1| uncharacterized protein LOC110424792 [Herran... 57 3e-07 >ref|XP_011073248.1| uncharacterized protein LOC105158260 [Sesamum indicum] Length = 98 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPS 50 GAGLL LHDD+QTCGYEDV +M+EMLR TES ++SR S Sbjct: 28 GAGLLKLHDDIQTCGYEDVQIMWEMLRQTESEVVSRHS 65 >gb|KJB57121.1| hypothetical protein B456_009G149300 [Gossypium raimondii] Length = 76 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPSN 47 GAGLL LHDDVQTCGYEDV VM+EMLR +ES L++ +N Sbjct: 28 GAGLLKLHDDVQTCGYEDVQVMWEMLRRSESELLAANNN 66 >ref|XP_019169497.1| PREDICTED: uncharacterized protein LOC109165264 [Ipomoea nil] Length = 124 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRP 53 GAGLL L DD+QTCGYEDV VM+EMLR TES L SRP Sbjct: 57 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELTSRP 93 >ref|XP_023891294.1| uncharacterized protein LOC112003339 [Quercus suber] gb|POE62089.1| hypothetical protein CFP56_29333 [Quercus suber] Length = 92 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRP 53 GAGLL LH+DVQTCGY+DV VM+EMLR +ES LIS P Sbjct: 28 GAGLLKLHNDVQTCGYQDVQVMWEMLRRSESELISHP 64 >ref|XP_012444343.1| PREDICTED: uncharacterized protein LOC105768746 [Gossypium raimondii] ref|XP_016688343.1| PREDICTED: uncharacterized protein LOC107906018 [Gossypium hirsutum] gb|KJB57122.1| hypothetical protein B456_009G149300 [Gossypium raimondii] Length = 94 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPSN 47 GAGLL LHDDVQTCGYEDV VM+EMLR +ES L++ +N Sbjct: 28 GAGLLKLHDDVQTCGYEDVQVMWEMLRRSESELLAANNN 66 >ref|XP_017607195.1| PREDICTED: uncharacterized protein LOC108453549 [Gossypium arboreum] gb|KHG10093.1| Negative regulator of sporulation MDS3 [Gossypium arboreum] gb|PPS02885.1| hypothetical protein GOBAR_AA17777 [Gossypium barbadense] Length = 94 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPSN 47 GAGLL LHDDVQTCGYEDV VM+EMLR +ES L++ +N Sbjct: 28 GAGLLKLHDDVQTCGYEDVQVMWEMLRRSESELMAANNN 66 >gb|KVI06104.1| hypothetical protein Ccrd_015555 [Cynara cardunculus var. scolymus] Length = 68 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 166 AGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPS 50 A GLL LHDD+QTCGYED+ VM+E+LR TESG S P+ Sbjct: 14 ARGGLLKLHDDIQTCGYEDIQVMWEILRRTESGATSNPA 52 >ref|XP_015071194.1| PREDICTED: uncharacterized protein LOC107015442 [Solanum pennellii] Length = 95 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISR 56 + GAGLL LHDD+QTCGYEDV VM+EMLR TES + +R Sbjct: 27 KKGAGLLKLHDDIQTCGYEDVQVMWEMLRKTESEVTNR 64 >ref|XP_016902643.1| PREDICTED: uncharacterized protein LOC107991796 [Cucumis melo] Length = 93 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLIS 59 + GAGLL LHDDV+TCGYEDV VM+EMLR +ES L+S Sbjct: 26 KTGAGLLKLHDDVETCGYEDVKVMWEMLRRSESELVS 62 >gb|KGN45194.1| hypothetical protein Csa_7G430780 [Cucumis sativus] Length = 93 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLIS 59 + GAGLL LHDDV+TCGYEDV VM+EMLR +ES L+S Sbjct: 26 KTGAGLLKLHDDVETCGYEDVKVMWEMLRRSESELVS 62 >gb|PHT88525.1| hypothetical protein T459_10631 [Capsicum annuum] gb|PHU24168.1| hypothetical protein BC332_09275 [Capsicum chinense] Length = 95 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISR 56 GAGLL LHDD+QTCGYEDV VM+EMLR TE+ + SR Sbjct: 29 GAGLLKLHDDIQTCGYEDVQVMWEMLRKTETEVTSR 64 >emb|CDO98267.1| unnamed protein product [Coffea canephora] Length = 95 Score = 59.7 bits (143), Expect = 5e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISR 56 GAGLL L DD+QTCGYEDV VM+EMLR TES L+SR Sbjct: 29 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELMSR 64 >gb|PHT47513.1| hypothetical protein CQW23_11721 [Capsicum baccatum] Length = 98 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISR 56 GAGLL LHDD+QTCGYEDV VM+EMLR TE+ + SR Sbjct: 32 GAGLLKLHDDIQTCGYEDVQVMWEMLRKTETEVTSR 67 >ref|XP_022954157.1| uncharacterized protein LOC111456503 [Cucurbita moschata] Length = 157 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRPSN*QA 38 ++GAGLL LHDDV+TCGYEDV VM+EMLR +ES L+ RP+ QA Sbjct: 26 KSGAGLLKLHDDVETCGYEDVKVMWEMLRRSESELV-RPTEAQA 68 >gb|PIN18198.1| hypothetical protein CDL12_09136 [Handroanthus impetiginosus] Length = 92 Score = 58.9 bits (141), Expect = 9e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLIS 59 GAGLL LHDD+QTCGYEDV +M+E+LR TES +IS Sbjct: 29 GAGLLKLHDDIQTCGYEDVQIMWEILRRTESEVIS 63 >ref|XP_023548962.1| uncharacterized protein LOC111807461 [Cucurbita pepo subsp. pepo] Length = 93 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLI 62 ++GAGLL LHDDV+TCGYEDV VM+EMLR +ES L+ Sbjct: 26 KSGAGLLKLHDDVETCGYEDVKVMWEMLRRSESELV 61 >gb|OMO65950.1| hypothetical protein COLO4_30895 [Corchorus olitorius] Length = 136 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLIS 59 GAGLLNLHDDVQTCGY+DV VM+EMLR +E+ LI+ Sbjct: 72 GAGLLNLHDDVQTCGYQDVQVMWEMLRRSETELIA 106 >ref|XP_012856221.1| PREDICTED: uncharacterized protein LOC105975567 [Erythranthe guttata] gb|EYU21784.1| hypothetical protein MIMGU_mgv1a016995mg [Erythranthe guttata] Length = 98 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISR 56 GAGLL LHDDVQTC YEDV +M+EMLR TES +IS+ Sbjct: 28 GAGLLKLHDDVQTCEYEDVQIMWEMLRRTESEIISQ 63 >ref|XP_011623851.1| uncharacterized protein LOC105420743 [Amborella trichopoda] Length = 88 Score = 57.4 bits (137), Expect = 3e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 169 RAGAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLISRP 53 R GAGLL LH+DVQTCGYEDV VM+EMLR +E+ ISRP Sbjct: 28 RNGAGLLKLHNDVQTCGYEDVQVMWEMLRRSETE-ISRP 65 >ref|XP_021295158.1| uncharacterized protein LOC110424792 [Herrania umbratica] Length = 92 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 163 GAGLLNLHDDVQTCGYEDVHVMYEMLRITESGLIS 59 GAGLL LHDDVQTCGY+DV VM+EMLR +E+ LI+ Sbjct: 28 GAGLLKLHDDVQTCGYQDVQVMWEMLRRSETELIA 62