BLASTX nr result
ID: Chrysanthemum21_contig00024341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024341 (610 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022003504.1| uncharacterized protein LOC110900958 [Helian... 56 4e-06 gb|OTF85744.1| putative nucleic acid-binding, OB-fold protein [H... 57 4e-06 ref|XP_022030896.1| replication protein A 70 kDa DNA-binding sub... 57 5e-06 ref|XP_021976366.1| replication protein A 70 kDa DNA-binding sub... 57 5e-06 gb|OTG18969.1| putative nucleic acid-binding, OB-fold protein [H... 57 5e-06 ref|XP_021990941.1| uncharacterized protein LOC110887672 [Helian... 56 7e-06 >ref|XP_022003504.1| uncharacterized protein LOC110900958 [Helianthus annuus] Length = 222 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESF 125 L+ S +AP LPS L + TKH FEIKSHTYY YG++ESF Sbjct: 96 LNDTSIDAPILPSALESLIGTKHTFEIKSHTYYRYGEYESF 136 >gb|OTF85744.1| putative nucleic acid-binding, OB-fold protein [Helianthus annuus] Length = 359 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESFT 128 L S +AP LPS L TKH FEIKSHTYY++GD+ESFT Sbjct: 233 LKDTSIDAPILPSALAALIGTKHTFEIKSHTYYHFGDYESFT 274 >ref|XP_022030896.1| replication protein A 70 kDa DNA-binding subunit C-like [Helianthus annuus] Length = 471 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESFT 128 L S +AP LPS L TKH FEIKSHTYY++GD+ESFT Sbjct: 345 LKDTSIDAPILPSALAALIGTKHTFEIKSHTYYHFGDYESFT 386 >ref|XP_021976366.1| replication protein A 70 kDa DNA-binding subunit C-like [Helianthus annuus] Length = 504 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESFT 128 L S +AP LPS L TKH FEIKSHTYY++GD+ESFT Sbjct: 378 LKDTSIDAPILPSALAALIGTKHTFEIKSHTYYHFGDYESFT 419 >gb|OTG18969.1| putative nucleic acid-binding, OB-fold protein [Helianthus annuus] Length = 537 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESFT 128 L S +AP LPS L TKH FEIKSHTYY++GD+ESFT Sbjct: 411 LKDTSIDAPILPSALAALIGTKHTFEIKSHTYYHFGDYESFT 452 >ref|XP_021990941.1| uncharacterized protein LOC110887672 [Helianthus annuus] Length = 253 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 3 LDQDSDNAPALPSVLTNQCNTKHVFEIKSHTYYNYGDFESF 125 L+ S +AP LPS L + TKH FEIKSHTYY YG++ESF Sbjct: 127 LNDTSLDAPLLPSALESLIGTKHTFEIKSHTYYRYGEYESF 167