BLASTX nr result
ID: Chrysanthemum21_contig00024283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024283 (868 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM67028.1| late elongated hypocotyl-like [Chrysanthemum set... 65 4e-12 >dbj|BAM67028.1| late elongated hypocotyl-like [Chrysanthemum seticuspe f. boreale] Length = 686 Score = 64.7 bits (156), Expect(2) = 4e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +2 Query: 239 YKKCSVEAKESEIVTASAGSRHNDEKCPKRMHLEEGTSS 355 YK+CS+EAKESEIVTASAGS NDEKCPKRM LE S+ Sbjct: 648 YKRCSIEAKESEIVTASAGSSQNDEKCPKRMRLEAEAST 686 Score = 35.4 bits (80), Expect(2) = 4e-12 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +3 Query: 162 VYRSGRSMEEWVLRMGLARVKLNVHH 239 V + +MEE VL+MGL VKLNVHH Sbjct: 617 VLKGDTNMEEGVLKMGLGSVKLNVHH 642