BLASTX nr result
ID: Chrysanthemum21_contig00024214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024214 (1338 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022022125.1| uncharacterized protein LOC110922100 [Helian... 45 9e-09 gb|PLY76158.1| hypothetical protein LSAT_4X36021 [Lactuca sativa] 45 3e-08 gb|KVH88199.1| NADH-ubiquinone reductase complex 1 MLRQ subunit ... 42 1e-06 >ref|XP_022022125.1| uncharacterized protein LOC110922100 [Helianthus annuus] gb|OTF87012.1| hypothetical protein HannXRQ_Chr17g0557071 [Helianthus annuus] Length = 156 Score = 45.1 bits (105), Expect(2) = 9e-09 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -3 Query: 193 TRQLIHHPGVQVNKSSRSMISKVDSPQL 110 T+QL HHPGVQVNK++RSM+ +VD+P + Sbjct: 70 TQQLFHHPGVQVNKTNRSMMPEVDTPDI 97 Score = 45.1 bits (105), Expect(2) = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 113 IAHAYGDKFISKSVIRKMAHI*KRDDTVARDR 18 IA A GDKF+++SV+RK+ HI KRDDTV+ DR Sbjct: 97 IALASGDKFMNRSVLRKVGHIQKRDDTVSMDR 128 >gb|PLY76158.1| hypothetical protein LSAT_4X36021 [Lactuca sativa] Length = 161 Score = 44.7 bits (104), Expect(2) = 3e-08 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -3 Query: 193 TRQLIHHPGVQVNKSSRSMISKVDSP 116 T QL HHPGVQVNK++RSM+ +VDSP Sbjct: 76 TMQLFHHPGVQVNKTNRSMMPEVDSP 101 Score = 43.9 bits (102), Expect(2) = 3e-08 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 110 AHAYGDKFISKSVIRKMAHI*KRDDTVARD 21 A A GDKFISKSV+RK+AHI KRDD V D Sbjct: 104 ALASGDKFISKSVLRKVAHIQKRDDAVPMD 133 >gb|KVH88199.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Cynara cardunculus var. scolymus] Length = 140 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 193 TRQLIHHPGVQVNKSSRSMISKVDSP 116 T+QL HHPGV VNK++RSM+ +VD P Sbjct: 56 TQQLFHHPGVHVNKANRSMVPEVDRP 81 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -2 Query: 110 AHAYGDKFISKSVIRKMAHI*KRDDTVARD 21 A A GDKFI+KSV+RK+AHI +RDD + D Sbjct: 84 ALASGDKFITKSVLRKVAHIQQRDDVIPMD 113