BLASTX nr result
ID: Chrysanthemum21_contig00024119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024119 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023753203.1| guanine nucleotide-binding protein-like NSN1... 60 6e-08 gb|KVI03821.1| GTP binding domain-containing protein, partial [C... 60 8e-08 ref|XP_021975732.1| guanine nucleotide-binding protein-like NSN1... 59 2e-07 ref|XP_010684929.1| PREDICTED: guanine nucleotide-binding protei... 57 1e-06 ref|XP_015088013.1| PREDICTED: guanine nucleotide-binding protei... 57 1e-06 ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] >... 57 1e-06 ref|XP_009772077.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucl... 57 1e-06 gb|KFK38161.1| hypothetical protein AALP_AA3G076800 [Arabis alpina] 56 2e-06 ref|XP_021857718.1| guanine nucleotide-binding protein-like NSN1... 56 2e-06 gb|KNA04978.1| hypothetical protein SOVF_194630 [Spinacia oleracea] 56 3e-06 ref|XP_019249461.1| PREDICTED: guanine nucleotide-binding protei... 55 3e-06 ref|XP_018821630.1| PREDICTED: guanine nucleotide-binding protei... 55 3e-06 emb|CDY66753.1| BnaCnng52210D [Brassica napus] 55 5e-06 ref|XP_015079725.1| PREDICTED: guanine nucleotide-binding protei... 55 5e-06 ref|XP_013749193.1| guanine nucleotide-binding protein-like NSN1... 55 5e-06 ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protei... 55 5e-06 ref|XP_015166521.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucl... 55 5e-06 ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protei... 55 5e-06 gb|PKI64791.1| hypothetical protein CRG98_014787 [Punica granatum] 55 6e-06 gb|OWM82883.1| hypothetical protein CDL15_Pgr005283 [Punica gran... 55 6e-06 >ref|XP_023753203.1| guanine nucleotide-binding protein-like NSN1 [Lactuca sativa] gb|PLY93509.1| hypothetical protein LSAT_5X179901 [Lactuca sativa] Length = 591 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 V +ILKLC AEMLVT YKIP F V+DFLS +A VR KL KG V++ Sbjct: 348 VKEILKLCPAEMLVTLYKIPAFDSVDDFLSKVATVRGKLKKGGVMD 393 >gb|KVI03821.1| GTP binding domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 617 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 V +ILKLC AEMLVT YKIP+F V+DFLS +A +R KL KG +++ Sbjct: 351 VKEILKLCPAEMLVTLYKIPIFNSVDDFLSKVATIRGKLKKGGLVD 396 >ref|XP_021975732.1| guanine nucleotide-binding protein-like NSN1 [Helianthus annuus] gb|OTG37053.1| putative guanine nucleotide-binding protein [Helianthus annuus] Length = 585 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC AE LVT YKIP F +DFLS +A VR KL KG VL+ D Sbjct: 347 VKEILKLCPAETLVTLYKIPTFNSDDDFLSKVATVRGKLKKGGVLDTD 394 >ref|XP_010684929.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Beta vulgaris subsp. vulgaris] gb|KMT05690.1| hypothetical protein BVRB_7g166980 [Beta vulgaris subsp. vulgaris] Length = 596 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -2 Query: 155 AKVMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 A V +ILKLC A++LVT YK+P F V++FL N+A VR +L KG V++ D Sbjct: 342 APVKEILKLCPAQVLVTLYKVPSFDTVDEFLQNVASVRGRLKKGGVVDVD 391 >ref|XP_015088013.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum pennellii] Length = 609 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC MLVT YKIP F V+DFL +A VR KL KG +++ D Sbjct: 355 VKEILKLCPERMLVTIYKIPTFDSVDDFLQKVAMVRGKLKKGGIVDTD 402 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC MLVT YKIP F V+DFL +A VR KL KG +++ D Sbjct: 355 VKEILKLCPERMLVTIYKIPTFDSVDDFLQKVAMVRGKLKKGGIVDTD 402 >ref|XP_009772077.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein-like 3 homolog [Nicotiana sylvestris] Length = 610 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC A MLVT YK+P F V+DFL +A VR KL KG V++ D Sbjct: 348 VKEILKLCPARMLVTIYKVPSFDSVDDFLQKVATVRGKLKKGGVVDID 395 >gb|KFK38161.1| hypothetical protein AALP_AA3G076800 [Arabis alpina] Length = 589 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 V +ILKLC+AEMLVT YKIP F V+DFL +A VR +L KG +++ Sbjct: 347 VKEILKLCTAEMLVTLYKIPAFEAVDDFLYKVATVRGRLKKGGLVD 392 >ref|XP_021857718.1| guanine nucleotide-binding protein-like NSN1 [Spinacia oleracea] Length = 598 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 155 AKVMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 A V +IL LC AE+LVT YK+P+F V+DFL +A VR +L KG +++ D Sbjct: 341 APVKEILNLCPAEVLVTLYKVPIFDTVDDFLFKVATVRGRLKKGGIVDVD 390 >gb|KNA04978.1| hypothetical protein SOVF_194630 [Spinacia oleracea] Length = 620 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 155 AKVMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 A V +IL LC AE+LVT YK+P+F V+DFL +A VR +L KG +++ D Sbjct: 363 APVKEILNLCPAEVLVTLYKVPIFDTVDDFLFKVATVRGRLKKGGIVDVD 412 >ref|XP_019249461.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana attenuata] gb|OIT07148.1| guanine nucleotide-binding protein-like nsn1 [Nicotiana attenuata] Length = 591 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC A MLVT YK+P F V+DFL +A VR KL KG +++ D Sbjct: 348 VKEILKLCPARMLVTIYKVPSFDSVDDFLQKVATVRGKLKKGGLVDID 395 >ref|XP_018821630.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Juglans regia] Length = 608 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC A +LVT YKIP F V+DFL +A VR KL KG +++ D Sbjct: 351 VKEILKLCPARLLVTLYKIPSFDSVDDFLQKVATVRGKLKKGGIVDVD 398 >emb|CDY66753.1| BnaCnng52210D [Brassica napus] Length = 513 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLCS +MLVT YKIP F V+DFL +A VR KL KG +++ + Sbjct: 262 VKEILKLCSTQMLVTLYKIPSFEGVDDFLYKVATVRGKLKKGGLVDTE 309 >ref|XP_015079725.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum pennellii] Length = 596 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC + MLVT YK+P F V+DFL +A VR +L KG +++ D Sbjct: 352 VKEILKLCPSSMLVTIYKVPSFDSVDDFLQKVATVRGRLKKGGIVDTD 399 >ref|XP_013749193.1| guanine nucleotide-binding protein-like NSN1 [Brassica napus] Length = 596 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLCS +MLVT YKIP F V+DFL +A VR KL KG +++ + Sbjct: 345 VKEILKLCSTQMLVTLYKIPSFEGVDDFLYKVATVRGKLKKGGLVDTE 392 >ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum lycopersicum] Length = 605 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC + MLVT YK+P F V+DFL +A VR +L KG +++ D Sbjct: 350 VKEILKLCPSSMLVTIYKVPSFDSVDDFLQKVATVRGRLKKGGIVDTD 397 >ref|XP_015166521.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein-like NSN1 [Solanum tuberosum] Length = 607 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC + MLVT YK+P F V+DFL +A VR +L KG +++ D Sbjct: 351 VKEILKLCPSSMLVTIYKVPSFDSVDDFLQKVATVRGRLKKGGIVDTD 398 >ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum tuberosum] Length = 608 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -2 Query: 149 VMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC MLVT YK+P F V+DFL +A VR KL KG +++ D Sbjct: 354 VKEILKLCPERMLVTIYKVPTFDSVDDFLQKVAMVRGKLKKGGIVDVD 401 >gb|PKI64791.1| hypothetical protein CRG98_014787 [Punica granatum] Length = 484 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -2 Query: 155 AKVMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 A V +ILKLC A++LVT YK+P F V DFL +A VR KL KG +++ Sbjct: 341 APVKEILKLCPAKVLVTLYKLPTFDSVNDFLQKVATVRGKLKKGGIVD 388 >gb|OWM82883.1| hypothetical protein CDL15_Pgr005283 [Punica granatum] Length = 588 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -2 Query: 155 AKVMKILKLCSAEMLVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 A V +ILKLC A++LVT YK+P F V DFL +A VR KL KG +++ Sbjct: 341 APVKEILKLCPAKVLVTLYKLPTFDSVNDFLQKVATVRGKLKKGGIVD 388