BLASTX nr result
ID: Chrysanthemum21_contig00024049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00024049 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989680.1| pentatricopeptide repeat-containing protein ... 119 1e-28 ref|XP_023741398.1| pentatricopeptide repeat-containing protein ... 115 3e-27 gb|KVI08360.1| Pentatricopeptide repeat-containing protein [Cyna... 115 6e-27 emb|CBI22491.3| unnamed protein product, partial [Vitis vinifera] 91 2e-18 ref|XP_002269471.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 ref|XP_012836873.1| PREDICTED: pentatricopeptide repeat-containi... 90 5e-18 gb|OMO63334.1| hypothetical protein COLO4_32549 [Corchorus olito... 89 9e-18 ref|XP_017226785.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_004230715.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-17 gb|PHU10501.1| Pentatricopeptide repeat-containing protein [Caps... 86 8e-17 gb|PHT63923.1| Pentatricopeptide repeat-containing protein [Caps... 86 8e-17 gb|PHT28802.1| Pentatricopeptide repeat-containing protein [Caps... 86 8e-17 ref|XP_016539460.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-17 ref|XP_006346330.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-17 gb|KYP47785.1| Pentatricopeptide repeat-containing protein At5g0... 86 9e-17 ref|XP_020234640.1| pentatricopeptide repeat-containing protein ... 86 1e-16 gb|PNT57392.1| hypothetical protein POPTR_001G297300v3 [Populus ... 86 1e-16 ref|XP_011030372.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-16 ref|XP_002298762.2| hypothetical protein POPTR_0001s30450g [Popu... 86 1e-16 gb|KZM81497.1| hypothetical protein DCAR_029110 [Daucus carota s... 86 1e-16 >ref|XP_021989680.1| pentatricopeptide repeat-containing protein At5g02860 [Helianthus annuus] gb|OTG12414.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 808 Score = 119 bits (299), Expect = 1e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEIA 244 YMIKQGC+PN STYNSIVDWYCKFHHRDDAVLFIN LREVDPRVS+DEISRLSARVA+IA Sbjct: 749 YMIKQGCKPNASTYNSIVDWYCKFHHRDDAVLFINKLREVDPRVSKDEISRLSARVAQIA 808 >ref|XP_023741398.1| pentatricopeptide repeat-containing protein At5g02860 [Lactuca sativa] gb|PLY68007.1| hypothetical protein LSAT_5X80001 [Lactuca sativa] Length = 813 Score = 115 bits (289), Expect = 3e-27 Identities = 51/59 (86%), Positives = 57/59 (96%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEI 247 YMIK GC+PNESTYNS++DWYCKFH RDDAVLFINNLREVDPRVS+DEISRL+ARVAE+ Sbjct: 754 YMIKNGCKPNESTYNSVIDWYCKFHRRDDAVLFINNLREVDPRVSKDEISRLAARVAEM 812 >gb|KVI08360.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 814 Score = 115 bits (287), Expect = 6e-27 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEIA 244 YMIKQGC+PNESTYNSIVDWYCKFH RDDAVLFIN LRE++PR+S+DEISRLSARVAE A Sbjct: 755 YMIKQGCKPNESTYNSIVDWYCKFHRRDDAVLFINKLRELEPRISKDEISRLSARVAETA 814 >emb|CBI22491.3| unnamed protein product, partial [Vitis vinifera] Length = 548 Score = 90.9 bits (224), Expect = 2e-18 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN+STYNSIVDWYCK + RD+A +F+NNLR++DP +S DE RLS R+A+ Sbjct: 479 YMIKHGCKPNQSTYNSIVDWYCKLNRRDEASMFVNNLRKLDPHISMDEECRLSERMAK 536 >ref|XP_002269471.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Vitis vinifera] Length = 811 Score = 90.9 bits (224), Expect = 2e-18 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN+STYNSIVDWYCK + RD+A +F+NNLR++DP +S DE RLS R+A+ Sbjct: 751 YMIKHGCKPNQSTYNSIVDWYCKLNRRDEASMFVNNLRKLDPHISMDEECRLSERMAK 808 >ref|XP_012836873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Erythranthe guttata] gb|EYU37598.1| hypothetical protein MIMGU_mgv1a025636mg [Erythranthe guttata] Length = 826 Score = 89.7 bits (221), Expect = 5e-18 Identities = 37/56 (66%), Positives = 49/56 (87%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMI+QGCRPN+STYNSIVDWYCK + D+AV+F+ +LR++DPR+S+DE RLS R+ Sbjct: 767 YMIRQGCRPNQSTYNSIVDWYCKLNRSDEAVMFVGDLRKLDPRISKDEERRLSERL 822 >gb|OMO63334.1| hypothetical protein COLO4_32549 [Corchorus olitorius] Length = 813 Score = 89.0 bits (219), Expect = 9e-18 Identities = 39/58 (67%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN+ TYNSIVD YCK RD+A+ FINNL+++DP +S+DE SRLSAR+AE Sbjct: 753 YMIKNGCKPNQYTYNSIVDGYCKLKRRDEAIEFINNLQKLDPHISKDEKSRLSARIAE 810 >ref|XP_017226785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Daucus carota subsp. sativus] Length = 836 Score = 87.0 bits (214), Expect = 4e-17 Identities = 36/59 (61%), Positives = 48/59 (81%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEI 247 YMIKQGCRPNESTYN+IVDWYCK + RD+A+ FI NLR++DP + + E +RL R +++ Sbjct: 759 YMIKQGCRPNESTYNAIVDWYCKLNRRDEAIKFIANLRQLDPHIRKGEETRLLGRTSKV 817 >ref|XP_004230715.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Solanum lycopersicum] Length = 819 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 761 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEETRLSARL 816 >gb|PHU10501.1| Pentatricopeptide repeat-containing protein [Capsicum chinense] Length = 821 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 763 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEKTRLSARL 818 >gb|PHT63923.1| Pentatricopeptide repeat-containing protein [Capsicum annuum] Length = 821 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 763 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEKTRLSARL 818 >gb|PHT28802.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 821 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 763 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEKTRLSARL 818 >ref|XP_016539460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Capsicum annuum] Length = 821 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 763 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEKTRLSARL 818 >ref|XP_006346330.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Solanum tuberosum] Length = 823 Score = 86.3 bits (212), Expect = 8e-17 Identities = 37/56 (66%), Positives = 50/56 (89%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARV 256 YMIKQGC+PN+STYNSI+D YCK + RD+A+ FINNLR+++P VS++E +RLSAR+ Sbjct: 765 YMIKQGCKPNDSTYNSIIDSYCKLNRRDEALAFINNLRKLNPHVSKEEETRLSARL 820 >gb|KYP47785.1| Pentatricopeptide repeat-containing protein At5g02860 family [Cajanus cajan] Length = 469 Score = 85.9 bits (211), Expect = 9e-17 Identities = 35/59 (59%), Positives = 49/59 (83%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEI 247 YMIK+GC+P+++TYNSIVDWYCK + RD+A+ F+ NL +DP VS+DE SRL R+A++ Sbjct: 409 YMIKRGCKPDQNTYNSIVDWYCKLNQRDEAISFVKNLGNLDPHVSKDEESRLLTRIAKM 467 >ref|XP_020234640.1| pentatricopeptide repeat-containing protein At5g02860-like [Cajanus cajan] Length = 789 Score = 85.9 bits (211), Expect = 1e-16 Identities = 35/59 (59%), Positives = 49/59 (83%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAEI 247 YMIK+GC+P+++TYNSIVDWYCK + RD+A+ F+ NL +DP VS+DE SRL R+A++ Sbjct: 729 YMIKRGCKPDQNTYNSIVDWYCKLNQRDEAISFVKNLGNLDPHVSKDEESRLLTRIAKM 787 >gb|PNT57392.1| hypothetical protein POPTR_001G297300v3 [Populus trichocarpa] gb|PNT57393.1| hypothetical protein POPTR_001G297300v3 [Populus trichocarpa] Length = 829 Score = 85.9 bits (211), Expect = 1e-16 Identities = 35/58 (60%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN++TYNS+VD YCK +HRDDA++FI++L E+DP +SR+E RLS R+ + Sbjct: 770 YMIKHGCKPNQNTYNSVVDGYCKHNHRDDAIMFISSLHELDPHISREEKCRLSERLTK 827 >ref|XP_011030372.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Populus euphratica] Length = 829 Score = 85.9 bits (211), Expect = 1e-16 Identities = 35/58 (60%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN++TYNS+VD YCK +HRDDA++FI++L E+DP +SR+E RLS R+ + Sbjct: 770 YMIKHGCKPNQNTYNSVVDGYCKHNHRDDAIMFISSLHELDPHISREEKCRLSERLTK 827 >ref|XP_002298762.2| hypothetical protein POPTR_0001s30450g [Populus trichocarpa] Length = 829 Score = 85.9 bits (211), Expect = 1e-16 Identities = 35/58 (60%), Positives = 49/58 (84%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIK GC+PN++TYNS+VD YCK +HRDDA++FI++L E+DP +SR+E RLS R+ + Sbjct: 770 YMIKHGCKPNQNTYNSVVDGYCKHNHRDDAIMFISSLHELDPHISREEKCRLSERLTK 827 >gb|KZM81497.1| hypothetical protein DCAR_029110 [Daucus carota subsp. sativus] Length = 838 Score = 85.9 bits (211), Expect = 1e-16 Identities = 36/58 (62%), Positives = 47/58 (81%) Frame = -1 Query: 423 YMIKQGCRPNESTYNSIVDWYCKFHHRDDAVLFINNLREVDPRVSRDEISRLSARVAE 250 YMIKQGCRPNESTYN+IVDWYCK + RD+A+ FI NLR++DP + + E +RL R ++ Sbjct: 759 YMIKQGCRPNESTYNAIVDWYCKLNRRDEAIKFIANLRQLDPHIRKGEETRLLGRTSK 816