BLASTX nr result
ID: Chrysanthemum21_contig00023992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023992 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF76189.1|AF271206_1 CTR1-like protein kinase, partial [Rosa... 53 1e-06 gb|KZV56400.1| Map3k delta-1 protein kinase isoform 3 [Dorcocera... 53 1e-06 dbj|BAH94716.1| Os09g0566500, partial [Oryza sativa Japonica Group] 53 2e-06 gb|OEL38235.1| Serine/threonine-protein kinase EDR1 [Dichantheli... 55 3e-06 emb|CAN80926.1| hypothetical protein VITISV_042797 [Vitis vinifera] 53 3e-06 ref|XP_017192683.1| PREDICTED: serine/threonine-protein kinase C... 52 3e-06 gb|AQK59727.1| Protein kinase domain superfamily protein [Zea ma... 53 3e-06 ref|XP_023737768.1| serine/threonine-protein kinase CTR1-like is... 55 3e-06 ref|XP_023745183.1| serine/threonine-protein kinase CTR1-like is... 55 3e-06 gb|ADD14035.1| CTR1 protein, partial [Brassica rapa subsp. chine... 54 3e-06 ref|XP_012089932.1| serine/threonine-protein kinase CTR1 [Jatrop... 55 4e-06 ref|XP_018817538.1| PREDICTED: serine/threonine-protein kinase C... 55 4e-06 ref|XP_022632088.1| serine/threonine-protein kinase CTR1 isoform... 55 4e-06 gb|OMO57583.1| hypothetical protein COLO4_35264 [Corchorus olito... 55 4e-06 gb|AQK71399.1| Serine/threonine-protein kinase CTR1 [Zea mays] >... 53 5e-06 ref|XP_010113189.1| serine/threonine-protein kinase CTR1 [Morus ... 53 5e-06 ref|XP_022773075.1| serine/threonine-protein kinase CTR1-like is... 55 5e-06 gb|PKI41412.1| hypothetical protein CRG98_038184 [Punica granatum] 52 5e-06 gb|AAS55707.1| CTR1, partial [Nicotiana benthamiana] 53 5e-06 gb|PHT50056.1| Serine/threonine-protein kinase CTR1 [Capsicum ba... 54 5e-06 >gb|AAF76189.1|AF271206_1 CTR1-like protein kinase, partial [Rosa hybrid cultivar] Length = 82 Score = 53.1 bits (126), Expect = 1e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 1 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 29 >gb|KZV56400.1| Map3k delta-1 protein kinase isoform 3 [Dorcoceras hygrometricum] Length = 71 Score = 52.8 bits (125), Expect = 1e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 302 QPEWMGPEVLRAESSNEKSDVYIFWVILWEKT 207 Q EWM PEVLR E SNEKSDVY F VILWE T Sbjct: 24 QNEWMAPEVLRDEPSNEKSDVYSFGVILWELT 55 >dbj|BAH94716.1| Os09g0566500, partial [Oryza sativa Japonica Group] Length = 114 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 1 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 29 >gb|OEL38235.1| Serine/threonine-protein kinase EDR1 [Dichanthelium oligosanthes] Length = 932 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PEVLR E SNEK DVY F VILWE Sbjct: 809 WNVKPEWMAPEVLRNEQSNEKCDVYSFGVILWE 841 >emb|CAN80926.1| hypothetical protein VITISV_042797 [Vitis vinifera] Length = 135 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 45 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 73 >ref|XP_017192683.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Malus domestica] ref|XP_008392658.2| PREDICTED: serine/threonine-protein kinase CTR1-like [Malus domestica] ref|XP_017192684.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Malus domestica] Length = 102 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 302 QPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 QP+WM PEVLR E SNEKSDV+ F VILWE Sbjct: 2 QPQWMAPEVLRNEPSNEKSDVFSFGVILWE 31 >gb|AQK59727.1| Protein kinase domain superfamily protein [Zea mays] gb|AQK59730.1| Protein kinase domain superfamily protein [Zea mays] gb|AQK59736.1| Protein kinase domain superfamily protein [Zea mays] Length = 139 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 302 QPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 QPEWM PEVLR E SNEK DVY F VILWE Sbjct: 36 QPEWMAPEVLRNEPSNEKCDVYSFGVILWE 65 >ref|XP_023737768.1| serine/threonine-protein kinase CTR1-like isoform X2 [Lactuca sativa] Length = 437 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 330 WTVKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 362 >ref|XP_023745183.1| serine/threonine-protein kinase CTR1-like isoform X2 [Lactuca sativa] Length = 437 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 330 WTVKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 362 >gb|ADD14035.1| CTR1 protein, partial [Brassica rapa subsp. chinensis] Length = 164 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 114 PEWMAPEVLRDEQSNEKSDVYSFGVILWE 142 >ref|XP_012089932.1| serine/threonine-protein kinase CTR1 [Jatropha curcas] gb|KDP45024.1| hypothetical protein JCGZ_01524 [Jatropha curcas] Length = 732 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR ESSNEKSDVY F VILWE Sbjct: 625 PEWMAPEVLRNESSNEKSDVYSFGVILWE 653 >ref|XP_018817538.1| PREDICTED: serine/threonine-protein kinase CTR1-like isoform X2 [Juglans regia] Length = 895 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 783 WTVKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 815 >ref|XP_022632088.1| serine/threonine-protein kinase CTR1 isoform X2 [Vigna radiata var. radiata] Length = 919 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 809 WTVKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 841 >gb|OMO57583.1| hypothetical protein COLO4_35264 [Corchorus olitorius] Length = 940 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 830 WTVKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 862 >gb|AQK71399.1| Serine/threonine-protein kinase CTR1 [Zea mays] gb|AQK71407.1| Serine/threonine-protein kinase CTR1 [Zea mays] gb|AQK71408.1| Serine/threonine-protein kinase CTR1 [Zea mays] gb|AQK71410.1| Serine/threonine-protein kinase CTR1 [Zea mays] Length = 160 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 54 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 82 >ref|XP_010113189.1| serine/threonine-protein kinase CTR1 [Morus notabilis] gb|EXC73207.1| Serine/threonine-protein kinase [Morus notabilis] Length = 164 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 54 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 82 >ref|XP_022773075.1| serine/threonine-protein kinase CTR1-like isoform X2 [Durio zibethinus] Length = 926 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 311 WGKQPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 W +PEWM PE LR E SNEKSDVY F VILWE Sbjct: 816 WTIKPEWMAPEFLRGEPSNEKSDVYSFGVILWE 848 >gb|PKI41412.1| hypothetical protein CRG98_038184 [Punica granatum] Length = 110 Score = 52.0 bits (123), Expect = 5e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 302 QPEWMGPEVLRAESSNEKSDVYIFWVILWE 213 QP+WM PEVLR E SNEKSDV+ F V+LWE Sbjct: 2 QPQWMAPEVLRNEPSNEKSDVFSFGVVLWE 31 >gb|AAS55707.1| CTR1, partial [Nicotiana benthamiana] Length = 168 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 299 PEWMGPEVLRAESSNEKSDVYIFWVILWE 213 PEWM PEVLR E SNEKSDVY F VILWE Sbjct: 57 PEWMAPEVLRDEPSNEKSDVYSFGVILWE 85 >gb|PHT50056.1| Serine/threonine-protein kinase CTR1 [Capsicum baccatum] Length = 232 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 302 QPEWMGPEVLRAESSNEKSDVYIFWVILWEKT 207 +PEWM PEVLR E NEKSDVY F VILWE+T Sbjct: 138 KPEWMAPEVLRDEPLNEKSDVYSFGVILWERT 169