BLASTX nr result
ID: Chrysanthemum21_contig00023709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023709 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX82325.1| somatic embryogenesis receptor kinase 1-like prot... 94 4e-21 ref|XP_018821342.1| PREDICTED: somatic embryogenesis receptor ki... 98 5e-21 ref|XP_021992274.1| somatic embryogenesis receptor kinase 1-like... 96 2e-20 gb|OTG06537.1| putative leucine-rich repeat protein, plant-type ... 96 2e-20 ref|XP_008246131.1| PREDICTED: somatic embryogenesis receptor ki... 88 3e-20 ref|XP_023770884.1| somatic embryogenesis receptor kinase 1-like... 96 3e-20 dbj|GAU13253.1| hypothetical protein TSUD_42070 [Trifolium subte... 94 5e-20 ref|XP_015886099.1| PREDICTED: somatic embryogenesis receptor ki... 94 8e-20 gb|ABW74475.1| somatic embryogenesis receptor kinase, partial [P... 92 1e-19 pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To B... 90 1e-19 gb|KMS99709.1| hypothetical protein BVRB_1g021420 [Beta vulgaris... 94 1e-19 ref|XP_019107767.1| PREDICTED: somatic embryogenesis receptor ki... 94 1e-19 ref|XP_010692604.1| PREDICTED: somatic embryogenesis receptor ki... 94 2e-19 ref|XP_015942457.1| somatic embryogenesis receptor kinase 2 [Ara... 94 2e-19 ref|XP_018809494.1| PREDICTED: somatic embryogenesis receptor ki... 93 2e-19 gb|KZV28934.1| somatic embryogenesis receptor kinase 1 [Dorcocer... 93 2e-19 ref|XP_014631457.1| PREDICTED: somatic embryogenesis receptor ki... 87 3e-19 gb|KZM98383.1| hypothetical protein DCAR_014255 [Daucus carota s... 92 3e-19 gb|AAB61708.1| somatic embryogenesis receptor-like kinase [Daucu... 92 4e-19 gb|AST48373.1| somatic embryogenesis receptor-like kinase [Paeon... 92 4e-19 >gb|PNX82325.1| somatic embryogenesis receptor kinase 1-like protein, partial [Trifolium pratense] Length = 198 Score = 93.6 bits (231), Expect = 4e-21 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNIT+LQVLDLSNNQLSG VPD+GSFSLFTPISFANN+ LCGPVTGH Sbjct: 126 MSLTNITALQVLDLSNNQLSGVVPDNGSFSLFTPISFANNLNLCGPVTGH 175 >ref|XP_018821342.1| PREDICTED: somatic embryogenesis receptor kinase 2 [Juglans regia] Length = 625 Score = 97.8 bits (242), Expect = 5e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNI+SLQVLDLSNNQLSGPVPD+GSFSLFTPISFANN GLCGPVTGH Sbjct: 159 MSLTNISSLQVLDLSNNQLSGPVPDNGSFSLFTPISFANNQGLCGPVTGH 208 >ref|XP_021992274.1| somatic embryogenesis receptor kinase 1-like isoform X1 [Helianthus annuus] ref|XP_021992275.1| somatic embryogenesis receptor kinase 1-like isoform X2 [Helianthus annuus] Length = 624 Score = 95.9 bits (237), Expect = 2e-20 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNITSLQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+GLCGPVTG Sbjct: 158 MSLTNITSLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLGLCGPVTG 206 >gb|OTG06537.1| putative leucine-rich repeat protein, plant-type [Helianthus annuus] Length = 625 Score = 95.9 bits (237), Expect = 2e-20 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNITSLQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+GLCGPVTG Sbjct: 158 MSLTNITSLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLGLCGPVTG 206 >ref|XP_008246131.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Prunus mume] Length = 75 Score = 87.8 bits (216), Expect = 3e-20 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNI+SLQVLDLSNNQLSG VP++GSFSLFTP+SFANN+ LCGPVTG Sbjct: 1 MSLTNISSLQVLDLSNNQLSGEVPNNGSFSLFTPLSFANNLNLCGPVTG 49 >ref|XP_023770884.1| somatic embryogenesis receptor kinase 1-like [Lactuca sativa] gb|PLY79978.1| hypothetical protein LSAT_9X42940 [Lactuca sativa] Length = 628 Score = 95.5 bits (236), Expect = 3e-20 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 + LTNITSLQVLDLSNN+LSGPVPDSGSFSLFTPISFANN+ LCGPVTGH Sbjct: 162 MPLTNITSLQVLDLSNNRLSGPVPDSGSFSLFTPISFANNLDLCGPVTGH 211 >dbj|GAU13253.1| hypothetical protein TSUD_42070 [Trifolium subterraneum] Length = 344 Score = 93.6 bits (231), Expect = 5e-20 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNIT+LQVLDLSNNQLSG VPD+GSFSLFTPISFANN+ LCGPVTGH Sbjct: 126 MSLTNITALQVLDLSNNQLSGVVPDNGSFSLFTPISFANNLNLCGPVTGH 175 >ref|XP_015886099.1| PREDICTED: somatic embryogenesis receptor kinase 2 [Ziziphus jujuba] Length = 628 Score = 94.4 bits (233), Expect = 8e-20 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNI+SLQVLDLSNN+LSG VPD+GSFSLFTPISFANN+GLCGPVTGH Sbjct: 162 MSLTNISSLQVLDLSNNRLSGEVPDNGSFSLFTPISFANNMGLCGPVTGH 211 >gb|ABW74475.1| somatic embryogenesis receptor kinase, partial [Paeonia suffruticosa] Length = 330 Score = 92.4 bits (228), Expect = 1e-19 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNIT+LQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 38 MSLTNITALQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 86 >pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain pdb|4LSX|D Chain D, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain Length = 203 Score = 89.7 bits (221), Expect = 1e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNIT+LQVLDLSNN+LSG VPD+GSFSLFTPISFANN+ LCGPVT H Sbjct: 140 MSLTNITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSH 189 >gb|KMS99709.1| hypothetical protein BVRB_1g021420 [Beta vulgaris subsp. vulgaris] Length = 546 Score = 93.6 bits (231), Expect = 1e-19 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNITSLQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 154 MSLTNITSLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 202 >ref|XP_019107767.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 572 Score = 93.6 bits (231), Expect = 1e-19 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNITSLQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 106 MSLTNITSLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 154 >ref|XP_010692604.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 620 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNITSLQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 154 MSLTNITSLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 202 >ref|XP_015942457.1| somatic embryogenesis receptor kinase 2 [Arachis duranensis] ref|XP_016176275.1| somatic embryogenesis receptor kinase 2 [Arachis ipaensis] Length = 624 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNI+SLQVLDLSNN LSG VPD+GSFSLFTPISFANN+GLCGPVTGH Sbjct: 158 MSLTNISSLQVLDLSNNHLSGVVPDNGSFSLFTPISFANNLGLCGPVTGH 207 >ref|XP_018809494.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Juglans regia] ref|XP_018809495.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Juglans regia] Length = 625 Score = 93.2 bits (230), Expect = 2e-19 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 +SLTNI+SLQVLDLSNN+LSG VPD+GSFSLFTPISFANN GLCGPVTGH Sbjct: 159 MSLTNISSLQVLDLSNNRLSGAVPDNGSFSLFTPISFANNQGLCGPVTGH 208 >gb|KZV28934.1| somatic embryogenesis receptor kinase 1 [Dorcoceras hygrometricum] Length = 634 Score = 93.2 bits (230), Expect = 2e-19 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNI+SLQVLDLSNNQLSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 153 MSLTNISSLQVLDLSNNQLSGPVPDNGSFSLFTPISFANNLDLCGPVTG 201 >ref|XP_014631457.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Glycine max] Length = 144 Score = 87.4 bits (215), Expect = 3e-19 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTGH 250 + L+NIT+LQ+LDLSNNQLSG VPDSGSFSLFTPISF NN+ LCGPVTGH Sbjct: 71 MPLSNITTLQMLDLSNNQLSGVVPDSGSFSLFTPISFNNNLDLCGPVTGH 120 >gb|KZM98383.1| hypothetical protein DCAR_014255 [Daucus carota subsp. sativus] Length = 465 Score = 92.4 bits (228), Expect = 3e-19 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNIT+LQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 1 MSLTNITTLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 49 >gb|AAB61708.1| somatic embryogenesis receptor-like kinase [Daucus carota] Length = 553 Score = 92.4 bits (228), Expect = 4e-19 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNIT+LQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 89 MSLTNITTLQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 137 >gb|AST48373.1| somatic embryogenesis receptor-like kinase [Paeonia suffruticosa] Length = 598 Score = 92.4 bits (228), Expect = 4e-19 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 399 LSLTNITSLQVLDLSNNQLSGPVPDSGSFSLFTPISFANNVGLCGPVTG 253 +SLTNIT+LQVLDLSNN+LSGPVPD+GSFSLFTPISFANN+ LCGPVTG Sbjct: 132 MSLTNITALQVLDLSNNRLSGPVPDNGSFSLFTPISFANNLNLCGPVTG 180