BLASTX nr result
ID: Chrysanthemum21_contig00023708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023708 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021969662.1| fructokinase-like 2, chloroplastic [Helianth... 96 1e-19 ref|XP_023731289.1| fructokinase-like 2, chloroplastic [Lactuca ... 69 3e-10 >ref|XP_021969662.1| fructokinase-like 2, chloroplastic [Helianthus annuus] gb|OTG22342.1| putative carbohydrate/puine kinase, PfkB, conserved site, Ribokinase-like protein [Helianthus annuus] Length = 624 Score = 95.9 bits (237), Expect = 1e-19 Identities = 54/96 (56%), Positives = 59/96 (61%), Gaps = 1/96 (1%) Frame = -1 Query: 542 TRGYPPKPGMEDDYFFPDPNGFKTINEKAYRTLLNV-DGDDSEDLGITVNRRXXXXXXXX 366 TRGYPPKPGMEDD FFPDPNG +TI EKA+RTL V D DDSE+LG+TVNR Sbjct: 530 TRGYPPKPGMEDDLFFPDPNGLRTITEKAFRTLFPVNDDDDSEELGVTVNRH-DDDSEEE 588 Query: 365 XXDNTDRHGXXXXXXXXXXXXXXXEPVRKGRQAIRA 258 DN DRH EPVRK Q+IRA Sbjct: 589 DGDNADRHNDYDSEDVSDMELDDEEPVRKVNQSIRA 624 >ref|XP_023731289.1| fructokinase-like 2, chloroplastic [Lactuca sativa] gb|PLY75831.1| hypothetical protein LSAT_3X53720 [Lactuca sativa] Length = 630 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -1 Query: 542 TRGYPPKPGMEDDYFFPDPNGFKTINEKAYRTLLNVDGDDSEDLGITVNR 393 TRGYPPKPGMEDD FF DPNG +TI++KA+RTL+ V+ ++ E++ + V R Sbjct: 531 TRGYPPKPGMEDDEFFSDPNGLRTISQKAFRTLIPVE-EEEEEVSLDVKR 579