BLASTX nr result
ID: Chrysanthemum21_contig00023696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023696 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021988849.1| calmodulin-binding protein 60 B-like isoform... 55 2e-06 ref|XP_021988848.1| calmodulin-binding protein 60 B-like isoform... 55 2e-06 gb|KVI11020.1| hypothetical protein Ccrd_010576 [Cynara carduncu... 54 9e-06 >ref|XP_021988849.1| calmodulin-binding protein 60 B-like isoform X2 [Helianthus annuus] ref|XP_021988850.1| calmodulin-binding protein 60 B-like isoform X2 [Helianthus annuus] Length = 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 7/48 (14%) Frame = -2 Query: 349 CFSRNGS------PRGRWCKIKAAMRWVTVWKDI-NRRMSEFDPFSSY 227 C SRNGS PRGRWCKI+AAM WV+V KD+ +RM+ FD FS + Sbjct: 415 CLSRNGSESGSGSPRGRWCKIRAAMIWVSVRKDVAAKRMAAFDLFSDF 462 >ref|XP_021988848.1| calmodulin-binding protein 60 B-like isoform X1 [Helianthus annuus] gb|OTG11489.1| putative CALMODULIN-BINDING PROTEIN60 [Helianthus annuus] Length = 500 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 7/48 (14%) Frame = -2 Query: 349 CFSRNGS------PRGRWCKIKAAMRWVTVWKDI-NRRMSEFDPFSSY 227 C SRNGS PRGRWCKI+AAM WV+V KD+ +RM+ FD FS + Sbjct: 451 CLSRNGSESGSGSPRGRWCKIRAAMIWVSVRKDVAAKRMAAFDLFSDF 498 >gb|KVI11020.1| hypothetical protein Ccrd_010576 [Cynara cardunculus var. scolymus] Length = 569 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/43 (51%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -2 Query: 349 CFSRNGSPRGRWCKIKAAMRWVTVWKDI-NRRMSEFDPFSSYS 224 CF RN SPR RWCKI+AA++WV+V +++ +RM+E P+ +S Sbjct: 526 CFPRNRSPRARWCKIRAAVKWVSVMRNVAAKRMAELYPYLDFS 568