BLASTX nr result
ID: Chrysanthemum21_contig00023684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023684 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015867843.1| PREDICTED: protein RRP6-like 2 [Ziziphus juj... 74 6e-13 gb|KVI09493.1| 3'-5' exonuclease domain-containing protein [Cyna... 74 1e-12 gb|PON53649.1| Ribonuclease D [Parasponia andersonii] 74 1e-12 ref|XP_022005926.1| protein RRP6-like 2 [Helianthus annuus] >gi|... 73 2e-12 gb|OTG09621.1| putative HRDC domain-containing protein [Helianth... 69 3e-12 gb|EOY10516.1| Polynucleotidyl transferase, ribonuclease H fold ... 72 4e-12 ref|XP_021281829.1| protein RRP6-like 2 [Herrania umbratica] 72 4e-12 ref|XP_007030013.2| PREDICTED: protein RRP6-like 2 [Theobroma ca... 72 4e-12 gb|EOY10515.1| Polynucleotidyl transferase, putative isoform 1 [... 72 4e-12 dbj|GAV88737.1| LOW QUALITY PROTEIN: HRDC domain-containing prot... 72 5e-12 ref|XP_021828801.1| protein RRP6-like 2 isoform X3 [Prunus avium] 72 5e-12 ref|XP_021828799.1| protein RRP6-like 2 isoform X1 [Prunus avium... 72 5e-12 gb|PON94283.1| Ribonuclease D [Trema orientalis] 72 5e-12 gb|OMO67884.1| hypothetical protein CCACVL1_20240 [Corchorus cap... 72 5e-12 gb|OMO70391.1| hypothetical protein COLO4_28619 [Corchorus olito... 72 5e-12 ref|XP_021888710.1| protein RRP6-like 2 isoform X2 [Carica papaya] 71 7e-12 ref|XP_021888709.1| protein RRP6-like 2 isoform X1 [Carica papaya] 71 7e-12 emb|CDP12658.1| unnamed protein product [Coffea canephora] 71 9e-12 ref|XP_006338891.1| PREDICTED: protein RRP6-like 2 [Solanum tube... 70 1e-11 ref|XP_015055970.1| PREDICTED: protein RRP6-like 2 [Solanum penn... 70 1e-11 >ref|XP_015867843.1| PREDICTED: protein RRP6-like 2 [Ziziphus jujuba] Length = 934 Score = 74.3 bits (181), Expect = 6e-13 Identities = 35/56 (62%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRDIVAR DE TGY+LPNKTL+EIAK MP T +L ++K++HP I+H+LGS Sbjct: 489 LCQWRDIVARAEDESTGYILPNKTLLEIAKQMPVTTSKLRQLIKSKHPYIEHNLGS 544 >gb|KVI09493.1| 3'-5' exonuclease domain-containing protein [Cynara cardunculus var. scolymus] Length = 777 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/56 (62%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGY+LPNK LIE+AK MP T G+L VMK+RHP I+ +LGS Sbjct: 499 LYEWRDVIARSEDESTGYILPNKVLIEVAKQMPVTPGKLRHVMKSRHPYIERNLGS 554 >gb|PON53649.1| Ribonuclease D [Parasponia andersonii] Length = 907 Score = 73.6 bits (179), Expect = 1e-12 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD+VAR DE TGY+LPNKTL+EIAK MP T +L ++K++HP I+H+LGS Sbjct: 492 LCEWRDVVARAEDESTGYILPNKTLLEIAKQMPVTTSQLRRLVKSKHPYIEHNLGS 547 >ref|XP_022005926.1| protein RRP6-like 2 [Helianthus annuus] gb|OTF99167.1| putative ribonuclease D, Exosome-associated factor Rrp6 [Helianthus annuus] Length = 874 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGY+LPNK LIEIAK MP T G+L ++K+RHP I+ +LGS Sbjct: 487 LCEWRDVIARSEDESTGYILPNKVLIEIAKQMPVTTGKLRHLLKSRHPYIERNLGS 542 >gb|OTG09621.1| putative HRDC domain-containing protein [Helianthus annuus] Length = 163 Score = 69.3 bits (168), Expect = 3e-12 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGY+LP K LIEIAK MP T G+L ++K+RHP I+ +LGS Sbjct: 70 LCQWRDVIARSEDESTGYLLPYKVLIEIAKQMPVTTGKLQHLLKSRHPYIERNLGS 125 >gb|EOY10516.1| Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain, putative isoform 2, partial [Theobroma cacao] gb|EOY10517.1| Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain, putative isoform 2, partial [Theobroma cacao] Length = 873 Score = 72.0 bits (175), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = +3 Query: 3 ALSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 AL WRDI+AR DE TGYVLPNKTL+EIAK MP T +L ++K++HP ++ +LGS Sbjct: 448 ALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLLKSKHPYVERNLGS 504 >ref|XP_021281829.1| protein RRP6-like 2 [Herrania umbratica] Length = 920 Score = 72.0 bits (175), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = +3 Query: 3 ALSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 AL WRDI+AR DE TGYVLPNKTL+EIAK MP T +L ++K++HP ++ +LGS Sbjct: 495 ALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTTSKLRRLLKSKHPYVERNLGS 551 >ref|XP_007030013.2| PREDICTED: protein RRP6-like 2 [Theobroma cacao] Length = 920 Score = 72.0 bits (175), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = +3 Query: 3 ALSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 AL WRDI+AR DE TGYVLPNKTL+EIAK MP T +L ++K++HP ++ +LGS Sbjct: 495 ALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLLKSKHPYVERNLGS 551 >gb|EOY10515.1| Polynucleotidyl transferase, putative isoform 1 [Theobroma cacao] Length = 920 Score = 72.0 bits (175), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = +3 Query: 3 ALSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 AL WRDI+AR DE TGYVLPNKTL+EIAK MP T +L ++K++HP ++ +LGS Sbjct: 495 ALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLLKSKHPYVERNLGS 551 >dbj|GAV88737.1| LOW QUALITY PROTEIN: HRDC domain-containing protein/DNA_pol_A_exo1 domain-containing protein, partial [Cephalotus follicularis] Length = 650 Score = 71.6 bits (174), Expect = 5e-12 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD+VAR DE TGY+LPNKTLIEIAK MP T +L V+K +HP ++ +LGS Sbjct: 257 LCEWRDVVARAEDESTGYILPNKTLIEIAKQMPVTANKLRRVLKTKHPYVERNLGS 312 >ref|XP_021828801.1| protein RRP6-like 2 isoform X3 [Prunus avium] Length = 667 Score = 71.6 bits (174), Expect = 5e-12 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD+VAR DE TGY+LPNKTL+EIAK MP T +L ++K++HP I+H+L S Sbjct: 484 LCEWRDVVARFEDESTGYILPNKTLLEIAKQMPVTTSKLKRLVKSKHPYIEHNLAS 539 >ref|XP_021828799.1| protein RRP6-like 2 isoform X1 [Prunus avium] ref|XP_021828800.1| protein RRP6-like 2 isoform X2 [Prunus avium] Length = 695 Score = 71.6 bits (174), Expect = 5e-12 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD+VAR DE TGY+LPNKTL+EIAK MP T +L ++K++HP I+H+L S Sbjct: 484 LCEWRDVVARFEDESTGYILPNKTLLEIAKQMPVTTSKLKRLVKSKHPYIEHNLAS 539 >gb|PON94283.1| Ribonuclease D [Trema orientalis] Length = 908 Score = 71.6 bits (174), Expect = 5e-12 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +3 Query: 15 WRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 WRD+VAR DE TGY+LPNKTL++IAK MP T +L ++K++HP I+H+LGS Sbjct: 495 WRDVVARAEDESTGYILPNKTLLDIAKQMPVTTSQLRRLVKSKHPYIEHNLGS 547 >gb|OMO67884.1| hypothetical protein CCACVL1_20240 [Corchorus capsularis] Length = 948 Score = 71.6 bits (174), Expect = 5e-12 Identities = 32/56 (57%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGYVLPNK L+EIAK MP+T G+L ++K++HP ++ +LGS Sbjct: 505 LCEWRDVIARAEDESTGYVLPNKVLLEIAKQMPTTAGKLRRLLKSKHPYVERNLGS 560 >gb|OMO70391.1| hypothetical protein COLO4_28619 [Corchorus olitorius] Length = 983 Score = 71.6 bits (174), Expect = 5e-12 Identities = 32/56 (57%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGYVLPNK L+EIAK MP+T G+L ++K++HP ++ +LGS Sbjct: 541 LCEWRDVIARAEDESTGYVLPNKVLLEIAKQMPTTAGKLRRLLKSKHPYVERNLGS 596 >ref|XP_021888710.1| protein RRP6-like 2 isoform X2 [Carica papaya] Length = 583 Score = 71.2 bits (173), Expect = 7e-12 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRDI+ARM DE TGY+LPN+TL+EIAK MP+T G+L ++K +HP I+ +L S Sbjct: 141 LCEWRDIIARMEDESTGYILPNRTLLEIAKQMPTTAGKLHRLIKPKHPYIERNLAS 196 >ref|XP_021888709.1| protein RRP6-like 2 isoform X1 [Carica papaya] Length = 586 Score = 71.2 bits (173), Expect = 7e-12 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRDI+ARM DE TGY+LPN+TL+EIAK MP+T G+L ++K +HP I+ +L S Sbjct: 144 LCEWRDIIARMEDESTGYILPNRTLLEIAKQMPTTAGKLHRLIKPKHPYIERNLAS 199 >emb|CDP12658.1| unnamed protein product [Coffea canephora] Length = 892 Score = 70.9 bits (172), Expect = 9e-12 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD+VAR DE TGYVLPNKTLIEIAK MP T +L +K++HP I+ +LGS Sbjct: 464 LCEWRDVVARAEDESTGYVLPNKTLIEIAKQMPLTTSKLKRSLKSKHPYIERNLGS 519 >ref|XP_006338891.1| PREDICTED: protein RRP6-like 2 [Solanum tuberosum] Length = 857 Score = 70.5 bits (171), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGYVLPNKTL EIAK MP T +L +MK++HP ++ +LGS Sbjct: 462 LHGWRDVIARAEDESTGYVLPNKTLTEIAKQMPLTPSKLKGLMKSKHPYVERNLGS 517 >ref|XP_015055970.1| PREDICTED: protein RRP6-like 2 [Solanum pennellii] Length = 861 Score = 70.5 bits (171), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +3 Query: 6 LSAWRDIVARMHDERTGYVLPNKTLIEIAK-MPSTIGELSDVMKNRHPLIDHHLGS 170 L WRD++AR DE TGYVLPNKTL EIAK MP T +L +MK++HP ++ +LGS Sbjct: 462 LHGWRDVIARAEDESTGYVLPNKTLTEIAKQMPLTPSKLKGMMKSKHPYVERNLGS 517