BLASTX nr result
ID: Chrysanthemum21_contig00023587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023587 (822 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021999344.1| transcription factor LHW-like [Helianthus an... 55 2e-06 >ref|XP_021999344.1| transcription factor LHW-like [Helianthus annuus] Length = 75 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 4/36 (11%) Frame = +1 Query: 1 HMLFLQSVTKHADKLKQTGESK----VWVYMYMLPS 96 HMLFLQSVTKHADKLKQTGESK VW Y + +PS Sbjct: 31 HMLFLQSVTKHADKLKQTGESKLQCRVWFYRWAVPS 66