BLASTX nr result
ID: Chrysanthemum21_contig00023483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023483 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021981939.1| oxidation resistance protein 1 [Helianthus a... 91 6e-19 gb|KVI00417.1| TLDc [Cynara cardunculus var. scolymus] 89 3e-18 ref|XP_023737950.1| nuclear receptor coactivator 7-like isoform ... 88 5e-18 ref|XP_023737949.1| nuclear receptor coactivator 7-like isoform ... 88 9e-18 ref|XP_023514740.1| TLD domain-containing protein 2-like isoform... 77 4e-15 gb|PHT33026.1| hypothetical protein CQW23_29363 [Capsicum baccatum] 76 2e-14 ref|XP_023527206.1| TLD domain-containing protein 2-like [Cucurb... 79 2e-14 ref|XP_022979474.1| oxidation resistance protein 1-like [Cucurbi... 79 2e-14 ref|XP_022924477.1| oxidation resistance protein 1-like [Cucurbi... 79 2e-14 ref|XP_008438466.1| PREDICTED: oxidation resistance protein 1 [C... 78 3e-14 ref|XP_023733903.1| oxidation resistance protein 1-like [Lactuca... 78 3e-14 ref|XP_021671095.1| oxidation resistance protein 1 [Hevea brasil... 78 4e-14 ref|XP_021899601.1| TLD domain-containing protein 2 [Carica papaya] 78 4e-14 ref|XP_023000528.1| TLD domain-containing protein 2-like isoform... 75 5e-14 ref|XP_023514739.1| oxidation resistance protein 1-like isoform ... 77 5e-14 ref|XP_022964535.1| oxidation resistance protein 1-like isoform ... 77 5e-14 ref|XP_023514738.1| oxidation resistance protein 1-like isoform ... 77 5e-14 ref|XP_022964533.1| oxidation resistance protein 1-like isoform ... 77 5e-14 gb|PHU01475.1| hypothetical protein BC332_31262 [Capsicum chinense] 77 5e-14 ref|XP_010670939.1| PREDICTED: TLD domain-containing protein 2 i... 77 6e-14 >ref|XP_021981939.1| oxidation resistance protein 1 [Helianthus annuus] gb|OTG37819.1| putative TLD-domain containing nucleolar protein [Helianthus annuus] Length = 326 Score = 90.9 bits (224), Expect = 6e-19 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRYP 176 LD DLL+GTSGRCDTFGNQCLAH+ESFALKNVELWGF HSSRYP Sbjct: 283 LDGDLLSGTSGRCDTFGNQCLAHDESFALKNVELWGFTHSSRYP 326 >gb|KVI00417.1| TLDc [Cynara cardunculus var. scolymus] Length = 299 Score = 88.6 bits (218), Expect = 3e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRYP 176 LD DLL+GTSGRCDTFGNQCLAH E+F LKNVELWGFAHSSRYP Sbjct: 256 LDGDLLSGTSGRCDTFGNQCLAHNEAFELKNVELWGFAHSSRYP 299 >ref|XP_023737950.1| nuclear receptor coactivator 7-like isoform X2 [Lactuca sativa] Length = 287 Score = 87.8 bits (216), Expect = 5e-18 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRYP 176 LDEDLL+GTSG DTFGNQCLAH+E+FALKNVELWGFAHSSRYP Sbjct: 244 LDEDLLHGTSGSSDTFGNQCLAHDEAFALKNVELWGFAHSSRYP 287 >ref|XP_023737949.1| nuclear receptor coactivator 7-like isoform X1 [Lactuca sativa] gb|PLY70592.1| hypothetical protein LSAT_1X75620 [Lactuca sativa] Length = 339 Score = 87.8 bits (216), Expect = 9e-18 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRYP 176 LDEDLL+GTSG DTFGNQCLAH+E+FALKNVELWGFAHSSRYP Sbjct: 296 LDEDLLHGTSGSSDTFGNQCLAHDEAFALKNVELWGFAHSSRYP 339 >ref|XP_023514740.1| TLD domain-containing protein 2-like isoform X3 [Cucurbita pepo subsp. pepo] Length = 161 Score = 77.4 bits (189), Expect = 4e-15 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 117 LDDDLLNGSSGPCDTFGSLCLAHDPEFELKNVELWGFAHASRY 159 >gb|PHT33026.1| hypothetical protein CQW23_29363 [Capsicum baccatum] Length = 180 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD DLL+G SG CDTFGN CLAH+E F LKNVELWGF H+SRY Sbjct: 135 LDGDLLSGNSGPCDTFGNLCLAHDEEFELKNVELWGFTHASRY 177 >ref|XP_023527206.1| TLD domain-containing protein 2-like [Cucurbita pepo subsp. pepo] Length = 330 Score = 78.6 bits (192), Expect = 2e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 L+EDLLNGTSG C+TFGN CLAH + F LKNVELWGFAH+S+Y Sbjct: 286 LEEDLLNGTSGPCETFGNSCLAHSQEFELKNVELWGFAHASQY 328 >ref|XP_022979474.1| oxidation resistance protein 1-like [Cucurbita maxima] Length = 330 Score = 78.6 bits (192), Expect = 2e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 L+EDLLNGTSG C+TFGN CLAH + F LKNVELWGFAH+S+Y Sbjct: 286 LEEDLLNGTSGPCETFGNSCLAHSQEFELKNVELWGFAHASQY 328 >ref|XP_022924477.1| oxidation resistance protein 1-like [Cucurbita moschata] Length = 330 Score = 78.6 bits (192), Expect = 2e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 L+EDLLNGTSG C+TFGN CLAH + F LKNVELWGFAH+S+Y Sbjct: 286 LEEDLLNGTSGPCETFGNSCLAHSQEFELKNVELWGFAHASQY 328 >ref|XP_008438466.1| PREDICTED: oxidation resistance protein 1 [Cucumis melo] Length = 318 Score = 78.2 bits (191), Expect = 3e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 L+EDLLNGTSG C+TFGN CLAH + F LKNVELWGFAH+S+Y Sbjct: 274 LEEDLLNGTSGPCETFGNSCLAHTQEFELKNVELWGFAHASQY 316 >ref|XP_023733903.1| oxidation resistance protein 1-like [Lactuca sativa] Length = 290 Score = 77.8 bits (190), Expect = 3e-14 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD DLL GTSG CDTFGN+CLAH E F LKNVELWGF HSSR+ Sbjct: 247 LDGDLLTGTSGPCDTFGNRCLAHNEEFELKNVELWGFTHSSRF 289 >ref|XP_021671095.1| oxidation resistance protein 1 [Hevea brasiliensis] Length = 318 Score = 77.8 bits (190), Expect = 4e-14 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD DLLNGTSG C+TFGN CLAHE F LKNVELWGF HSS+Y Sbjct: 274 LDGDLLNGTSGPCETFGNLCLAHEPEFVLKNVELWGFTHSSKY 316 >ref|XP_021899601.1| TLD domain-containing protein 2 [Carica papaya] Length = 326 Score = 77.8 bits (190), Expect = 4e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +3 Query: 42 SLDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 SLD DLL+GTSG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 281 SLDGDLLSGTSGPCDTFGSSCLAHKSEFELKNVELWGFAHASRY 324 >ref|XP_023000528.1| TLD domain-containing protein 2-like isoform X3 [Cucurbita maxima] Length = 161 Score = 74.7 bits (182), Expect = 5e-14 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTF + CLAH+ F LKNVELWGFAH+SRY Sbjct: 117 LDDDLLNGSSGPCDTFDSLCLAHDPEFELKNVELWGFAHASRY 159 >ref|XP_023514739.1| oxidation resistance protein 1-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 314 Score = 77.4 bits (189), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 270 LDDDLLNGSSGPCDTFGSLCLAHDPEFELKNVELWGFAHASRY 312 >ref|XP_022964535.1| oxidation resistance protein 1-like isoform X2 [Cucurbita moschata] Length = 314 Score = 77.4 bits (189), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 270 LDDDLLNGSSGPCDTFGSLCLAHDPEFELKNVELWGFAHASRY 312 >ref|XP_023514738.1| oxidation resistance protein 1-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 317 Score = 77.4 bits (189), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 273 LDDDLLNGSSGPCDTFGSLCLAHDPEFELKNVELWGFAHASRY 315 >ref|XP_022964533.1| oxidation resistance protein 1-like isoform X1 [Cucurbita moschata] Length = 317 Score = 77.4 bits (189), Expect = 5e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD+DLLNG+SG CDTFG+ CLAH+ F LKNVELWGFAH+SRY Sbjct: 273 LDDDLLNGSSGPCDTFGSLCLAHDPEFELKNVELWGFAHASRY 315 >gb|PHU01475.1| hypothetical protein BC332_31262 [Capsicum chinense] Length = 321 Score = 77.4 bits (189), Expect = 5e-14 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 45 LDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 LD DLL+G SG CDTFGN CLAH+E F LKNVELWGF HSSRY Sbjct: 276 LDGDLLSGNSGPCDTFGNLCLAHDEEFELKNVELWGFTHSSRY 318 >ref|XP_010670939.1| PREDICTED: TLD domain-containing protein 2 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT16533.1| hypothetical protein BVRB_3g048270 [Beta vulgaris subsp. vulgaris] Length = 312 Score = 77.0 bits (188), Expect = 6e-14 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 42 SLDEDLLNGTSGRCDTFGNQCLAHEESFALKNVELWGFAHSSRY 173 SLDEDLL G+SG C TFGN CLAH+ F LKNVELWGF HSSRY Sbjct: 267 SLDEDLLAGSSGPCQTFGNTCLAHDSGFELKNVELWGFTHSSRY 310