BLASTX nr result
ID: Chrysanthemum21_contig00023172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023172 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021657587.1| uncharacterized protein LOC110647870 [Hevea ... 56 8e-06 ref|XP_021615209.1| uncharacterized protein LOC110616970 [Maniho... 56 8e-06 >ref|XP_021657587.1| uncharacterized protein LOC110647870 [Hevea brasiliensis] Length = 702 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +2 Query: 377 EFFNDVPVNLIPYNLHTKSILTDIEYGHISTGIPLDDMKCKYVNGTILCEV 529 E FNDVP L+PY+ ++++ T IEYG + G D + CKYVNG +LCE+ Sbjct: 90 EVFNDVPKQLVPYDRASETLFTAIEYGWL-PGDVFDQIPCKYVNGAVLCEI 139 >ref|XP_021615209.1| uncharacterized protein LOC110616970 [Manihot esculenta] gb|OAY47236.1| hypothetical protein MANES_06G063600 [Manihot esculenta] Length = 940 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +2 Query: 377 EFFNDVPVNLIPYNLHTKSILTDIEYGHISTGIPLDDMKCKYVNGTILCEV 529 E FNDVP LIPY+ +++ T IEYG + I D + CKYVNG +LCE+ Sbjct: 92 EVFNDVPKQLIPYDRASEAFFTAIEYGWLPGDI-FDQISCKYVNGAVLCEI 141