BLASTX nr result
ID: Chrysanthemum21_contig00023054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023054 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI07377.1| BTB/Kelch-associated [Cynara cardunculus var. sco... 77 6e-14 ref|XP_022013126.1| BTB/POZ domain-containing protein At2g30600 ... 74 1e-12 ref|XP_023772572.1| BTB/POZ domain-containing protein At2g30600 ... 69 4e-11 ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein... 60 9e-08 emb|CDY29657.1| BnaA04g17700D [Brassica napus] 59 1e-07 ref|XP_011074097.1| BTB/POZ domain-containing protein At2g30600 ... 59 2e-07 ref|XP_021810211.1| BTB/POZ domain-containing protein At2g30600 ... 59 2e-07 ref|XP_024163407.1| BTB/POZ domain-containing protein At2g30600 ... 58 3e-07 ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein... 58 3e-07 dbj|GAV63477.1| BTB domain-containing protein/F5_F8_type_C domai... 58 3e-07 ref|XP_007221940.1| BTB/POZ domain-containing protein At2g30600 ... 58 3e-07 ref|XP_017189303.1| PREDICTED: BTB/POZ domain-containing protein... 58 4e-07 ref|XP_017189302.1| PREDICTED: BTB/POZ domain-containing protein... 58 4e-07 ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein... 58 4e-07 ref|XP_010094552.1| BTB/POZ domain-containing protein At2g30600 ... 58 4e-07 gb|PON60550.1| Voltage dependent potassium channel [Parasponia a... 57 6e-07 gb|PIM99645.1| putative hormone receptor interactor [Handroanthu... 57 6e-07 gb|PON90458.1| Voltage dependent potassium channel [Trema orient... 57 6e-07 emb|CBI40712.3| unnamed protein product, partial [Vitis vinifera] 57 8e-07 ref|XP_017247041.1| PREDICTED: BTB/POZ domain-containing protein... 57 8e-07 >gb|KVI07377.1| BTB/Kelch-associated [Cynara cardunculus var. scolymus] Length = 702 Score = 77.4 bits (189), Expect = 6e-14 Identities = 38/48 (79%), Positives = 38/48 (79%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 YFYSG FNLEDTVDSN LADQFGVSLLHQDCCK LLERLSE Sbjct: 400 YFYSGGFNLEDTVDSNILLLELVLLADQFGVSLLHQDCCKTLLERLSE 447 >ref|XP_022013126.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013127.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013128.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013129.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013130.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013131.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] ref|XP_022013132.1| BTB/POZ domain-containing protein At2g30600 [Helianthus annuus] gb|OTF96292.1| putative BTB/POZ domain-containing protein [Helianthus annuus] Length = 803 Score = 73.6 bits (179), Expect = 1e-12 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 YFYSG NLEDTV+SN LADQFGVSLLHQDCCK LLERLSE Sbjct: 406 YFYSGGLNLEDTVESNILLLELLLLADQFGVSLLHQDCCKTLLERLSE 453 >ref|XP_023772572.1| BTB/POZ domain-containing protein At2g30600 [Lactuca sativa] ref|XP_023772573.1| BTB/POZ domain-containing protein At2g30600 [Lactuca sativa] ref|XP_023772574.1| BTB/POZ domain-containing protein At2g30600 [Lactuca sativa] gb|PLY78724.1| hypothetical protein LSAT_9X45201 [Lactuca sativa] Length = 806 Score = 69.3 bits (168), Expect = 4e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 YFY+G NLE+TVD+N LADQFGVSLLHQDCCK LLE+LSE Sbjct: 409 YFYNGGLNLENTVDTNILLLELLLLADQFGVSLLHQDCCKTLLEQLSE 456 >ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus mume] ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus mume] ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus mume] ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus mume] Length = 805 Score = 59.7 bits (143), Expect = 9e-08 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLL 215 + YSG N+E T+DS LADQFGV+LLHQ+CCK LLE LSE + ++L Sbjct: 406 FMYSGELNIEATIDSGALLLQLFLLADQFGVTLLHQECCKTLLEYLSEDSVCSIL 460 >emb|CDY29657.1| BnaA04g17700D [Brassica napus] Length = 844 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLLCFLIL 200 + YSG N+EDTV+ LAD+FGV LHQ+CCK LLE LSEV+ + + Sbjct: 402 FMYSGELNMEDTVNFGTDLIHLLFLADRFGVVPLHQECCKMLLECLSEVIFSSQSSLVDD 461 Query: 199 FNVLTFYLNIVFDYG 155 ++ ++L+++F G Sbjct: 462 ASLFCYHLSLIFQKG 476 >ref|XP_011074097.1| BTB/POZ domain-containing protein At2g30600 [Sesamum indicum] Length = 804 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG N EDT+D + LADQFGVSLLHQ+CCK LLE LSE Sbjct: 406 FMYSGEVNKEDTMDIDTLLLQLLLLADQFGVSLLHQECCKRLLEHLSE 453 >ref|XP_021810211.1| BTB/POZ domain-containing protein At2g30600 [Prunus avium] ref|XP_021810212.1| BTB/POZ domain-containing protein At2g30600 [Prunus avium] ref|XP_021810213.1| BTB/POZ domain-containing protein At2g30600 [Prunus avium] ref|XP_021810214.1| BTB/POZ domain-containing protein At2g30600 [Prunus avium] Length = 805 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG NLE T+DS LADQ+GV+LLHQ+CCK LLE LSE Sbjct: 406 FMYSGELNLEATIDSGALLLQLFLLADQYGVTLLHQECCKTLLEYLSE 453 >ref|XP_024163407.1| BTB/POZ domain-containing protein At2g30600 [Rosa chinensis] ref|XP_024163408.1| BTB/POZ domain-containing protein At2g30600 [Rosa chinensis] gb|PRQ27348.1| putative chromatin remodeling & transcription regulator BTB-POZ family [Rosa chinensis] Length = 800 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG NLE T+DS LADQFGV+LLHQ+CCK LLE LSE Sbjct: 401 FMYSGELNLEATMDSGALLLQLFLLADQFGVTLLHQECCKMLLECLSE 448 >ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria vesca subsp. vesca] ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria vesca subsp. vesca] Length = 803 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG NLE T+DS LADQFGV+LLHQ+CCK LLE LSE Sbjct: 404 FMYSGELNLEATMDSGDMLLHLFLLADQFGVTLLHQECCKMLLECLSE 451 >dbj|GAV63477.1| BTB domain-containing protein/F5_F8_type_C domain-containing protein/BACK domain-containing protein/Methyltransf_FA domain-containing protein [Cephalotus follicularis] Length = 804 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG N+EDT+D LADQFGV+LLHQ+CCK LLE LSE Sbjct: 405 FMYSGELNMEDTMDFGNLLLPLLLLADQFGVTLLHQECCKILLECLSE 452 >ref|XP_007221940.1| BTB/POZ domain-containing protein At2g30600 [Prunus persica] ref|XP_020421512.1| BTB/POZ domain-containing protein At2g30600 [Prunus persica] gb|ONI32199.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32200.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32201.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32202.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32203.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32204.1| hypothetical protein PRUPE_1G353800 [Prunus persica] gb|ONI32205.1| hypothetical protein PRUPE_1G353800 [Prunus persica] Length = 805 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG NLE T+DS LADQFGV+LLHQ+CCK LLE LS+ Sbjct: 406 FMYSGELNLEATIDSGALLLQLFLLADQFGVTLLHQECCKTLLEYLSK 453 >ref|XP_017189303.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X3 [Malus domestica] Length = 797 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG +LE TVDS LADQFGV+LLHQ+CCK LLE LSE Sbjct: 406 FMYSGELSLEATVDSGALLLQLFLLADQFGVTLLHQECCKKLLEYLSE 453 >ref|XP_017189302.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Malus domestica] Length = 803 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG +LE TVDS LADQFGV+LLHQ+CCK LLE LSE Sbjct: 406 FMYSGELSLEATVDSGALLLQLFLLADQFGVTLLHQECCKKLLEYLSE 453 >ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Malus domestica] ref|XP_017189301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Malus domestica] Length = 805 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + YSG +LE TVDS LADQFGV+LLHQ+CCK LLE LSE Sbjct: 406 FMYSGELSLEATVDSGALLLQLFLLADQFGVTLLHQECCKKLLEYLSE 453 >ref|XP_010094552.1| BTB/POZ domain-containing protein At2g30600 [Morus notabilis] gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 810 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLL 215 + YSG NLE T++S LADQFGV+LLHQ+CCK LLE LSE + +L Sbjct: 411 FMYSGELNLEVTMESGALLLQLLLLADQFGVTLLHQECCKTLLEWLSEDTVFPIL 465 >gb|PON60550.1| Voltage dependent potassium channel [Parasponia andersonii] Length = 804 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLL 215 + YSG NLE T++S LADQFGV+LLHQ+CCK LLE LSE + +L Sbjct: 405 FMYSGELNLEVTMESGALLLQLLLLADQFGVTLLHQECCKTLLECLSEDTVCPIL 459 >gb|PIM99645.1| putative hormone receptor interactor [Handroanthus impetiginosus] Length = 804 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE 236 + Y+G N EDT D + LADQFGVSLLHQ+CCK LLE LSE Sbjct: 406 FMYTGEVNKEDTTDIDTLLLQLLLLADQFGVSLLHQECCKRLLEHLSE 453 >gb|PON90458.1| Voltage dependent potassium channel [Trema orientalis] Length = 805 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLL 215 + YSG NLE T++S LADQFGV+LLHQ+CCK LLE LSE + +L Sbjct: 406 FMYSGELNLEVTMESGALLLQLLLLADQFGVTLLHQECCKTLLECLSEDTVCPIL 460 >emb|CBI40712.3| unnamed protein product, partial [Vitis vinifera] Length = 789 Score = 57.0 bits (136), Expect = 8e-07 Identities = 32/67 (47%), Positives = 40/67 (59%), Gaps = 8/67 (11%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSE--------VVLI 224 + YSG +++DT+D+ LADQFGV+LLHQ+CCK LLE LSE VV Sbjct: 390 FMYSGKLDIDDTMDTGTLLLQLLLLADQFGVALLHQECCKTLLECLSEDSVCPILQVVSS 449 Query: 223 TLLCFLI 203 L C LI Sbjct: 450 VLSCKLI 456 >ref|XP_017247041.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Daucus carota subsp. sativus] ref|XP_017247042.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Daucus carota subsp. sativus] Length = 805 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = -3 Query: 379 YFYSGAFNLEDTVDSNXXXXXXXXLADQFGVSLLHQDCCKALLERLSEVVLITLL 215 Y YSG FN E+ +D LADQFGVS LHQ+CCK LLE LSE ++ +L Sbjct: 408 YMYSGEFNKENIMDIGILLLQLLLLADQFGVSALHQECCKTLLECLSEDLVCPIL 462