BLASTX nr result
ID: Chrysanthemum21_contig00023018
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00023018 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH97750.1| Galactose oxidase, beta-propeller [Cynara cardunc... 65 1e-09 >gb|KVH97750.1| Galactose oxidase, beta-propeller [Cynara cardunculus var. scolymus] Length = 439 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +1 Query: 109 FMSNCRIERIESH-EKRPLELEDEEVVHARKICKQSSGF 222 FMSNCRIE+IESH EKRPLE+ D+EVVHARKI KQS+G+ Sbjct: 23 FMSNCRIEKIESHHEKRPLEIGDDEVVHARKILKQSNGY 61