BLASTX nr result
ID: Chrysanthemum21_contig00022922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022922 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI01963.1| LytB protein [Cynara cardunculus var. scolymus] 55 8e-09 gb|API85526.1| 1-hydroxy-2-methyl-2-(E)-butenyl- 4-diphosphate r... 57 3e-08 gb|AMB19711.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 57 3e-08 gb|ALJ30091.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 54 1e-07 ref|XP_023747484.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 55 1e-07 ref|XP_021976748.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 54 2e-07 gb|ABB88836.2| IPP/DMAPP synthase [Stevia rebaudiana] 56 2e-07 ref|XP_023747587.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 54 7e-07 ref|XP_022006535.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 54 7e-07 gb|PLY63346.1| hypothetical protein LSAT_7X89821 [Lactuca sativa] 54 7e-07 ref|XP_023769659.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 54 8e-07 gb|OAY84506.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 57 2e-06 ref|XP_020104485.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 57 2e-06 gb|OAY84500.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 57 2e-06 ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 51 2e-06 emb|CBI32545.3| unnamed protein product, partial [Vitis vinifera] 51 2e-06 ref|XP_020241009.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 55 3e-06 gb|OTF90929.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate... 50 4e-06 gb|AMB19713.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 54 4e-06 ref|XP_022016966.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 50 4e-06 >gb|KVI01963.1| LytB protein [Cynara cardunculus var. scolymus] Length = 859 Score = 55.5 bits (132), Expect(2) = 8e-09 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIPI+DG + FDV DK DVV+ AFG Sbjct: 145 IIHNPTVNKRLEEMEVKDIPIEDGSKQFDVVDKGDVVILPAFG 187 Score = 32.0 bits (71), Expect(2) = 8e-09 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATCF*ALGISFIWYVICFTFI*KFSGTS----VYLQYCKFAVF 309 AV+E+LTLSN+ + VD TC +S YV + K +G+S +L+ KFAV Sbjct: 189 AVDEMLTLSNKQVQIVDTTC---PWVSKATYVCDYILGGKLNGSSSTKEAFLEKFKFAVS 245 Query: 310 *DFD 321 FD Sbjct: 246 KGFD 249 Score = 53.1 bits (126), Expect(2) = 1e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVK IPIKDG + FDV DK DVV+ AFG Sbjct: 503 IIHNPTVNKRLEEMEVKFIPIKDGSKQFDVIDKGDVVILPAFG 545 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+LTLSN+ + VD TC Sbjct: 547 AVDEMLTLSNKQVQIVDTTC 566 >gb|API85526.1| 1-hydroxy-2-methyl-2-(E)-butenyl- 4-diphosphate reductase [Artemisia annua] Length = 454 Score = 57.0 bits (136), Expect(2) = 3e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIP+KDG + FDV DK DVVV AFG Sbjct: 138 IIHNPTVNKRLEEMEVKDIPVKDGEKQFDVVDKGDVVVLPAFG 180 Score = 28.5 bits (62), Expect(2) = 3e-08 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 182 AVNEMLTLSNKGVQIVDTTC 201 >gb|AMB19711.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1, partial [Taraxacum kok-saghyz] Length = 446 Score = 57.0 bits (136), Expect(2) = 3e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIPIKDG + FDV DK DVVV AFG Sbjct: 141 IIHNPTVNKRLEEMEVKDIPIKDGEKQFDVIDKGDVVVLPAFG 183 Score = 28.5 bits (62), Expect(2) = 3e-08 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 185 AVNEMLTLSNKQVQIVDTTC 204 >gb|ALJ30091.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase 2 [Stevia rebaudiana] Length = 459 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RL+EMEVKDIPI+DG + FDV DK DVV+ AFG Sbjct: 143 IIHNPTVNKRLDEMEVKDIPIEDGEKQFDVVDKGDVVILPAFG 185 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATCF*ALGISFIWYVI 240 AVNE+LTL+N+ + VD TC +S +W V+ Sbjct: 187 AVNEMLTLNNKQVQIVDTTC---PWVSKVWNVV 216 >ref|XP_023747484.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Lactuca sativa] gb|PLY63378.1| hypothetical protein LSAT_7X89801 [Lactuca sativa] Length = 458 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIP+KDG + FDV +K DVVV AFG Sbjct: 142 IIHNPTVNKRLEEMEVKDIPVKDGEKQFDVINKGDVVVLPAFG 184 Score = 28.5 bits (62), Expect(2) = 1e-07 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 186 AVNEMLTLSNKQVQIVDTTC 205 >ref|XP_021976748.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Helianthus annuus] gb|OTG17832.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helianthus annuus] Length = 485 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLE+MEVKDIPI+DG + FDV DK DVV+ AFG Sbjct: 169 IIHNPTVNKRLEDMEVKDIPIEDGEKQFDVVDKGDVVILPAFG 211 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 213 AVNEMLTLSNKQVQIVDTTC 232 >gb|ABB88836.2| IPP/DMAPP synthase [Stevia rebaudiana] Length = 458 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIP+KDG + FDV DK DVV+ AFG Sbjct: 142 IIHNPTVNKRLEEMEVKDIPVKDGEKQFDVIDKGDVVILPAFG 184 Score = 26.6 bits (57), Expect(2) = 2e-07 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLS++ + VD TC Sbjct: 186 AVNEMLTLSDKQVQIVDTTC 205 >ref|XP_023747587.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Lactuca sativa] Length = 455 Score = 53.9 bits (128), Expect(2) = 7e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEME+K IPIKDG + FDV DK DVVV AFG Sbjct: 142 IIHNPTVNKRLEEMEIKGIPIKDGEKQFDVIDKGDVVVLPAFG 184 Score = 26.9 bits (58), Expect(2) = 7e-07 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTL N+ + VD TC Sbjct: 186 AVNEMLTLKNKQVQIVDTTC 205 >ref|XP_022006535.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Helianthus annuus] gb|OTF99823.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helianthus annuus] Length = 449 Score = 54.3 bits (129), Expect(2) = 7e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RL+EMEVKDIPI+DG + FDV DK DVV+ AFG Sbjct: 133 IIHNPTVNKRLQEMEVKDIPIQDGEKQFDVVDKGDVVILPAFG 175 Score = 26.6 bits (57), Expect(2) = 7e-07 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+LTLSN+ + VD TC Sbjct: 177 AVSEMLTLSNKQVQIVDTTC 196 >gb|PLY63346.1| hypothetical protein LSAT_7X89821 [Lactuca sativa] Length = 363 Score = 53.9 bits (128), Expect(2) = 7e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEME+K IPIKDG + FDV DK DVVV AFG Sbjct: 142 IIHNPTVNKRLEEMEIKGIPIKDGEKQFDVIDKGDVVVLPAFG 184 Score = 26.9 bits (58), Expect(2) = 7e-07 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTL N+ + VD TC Sbjct: 186 AVNEMLTLKNKQVQIVDTTC 205 >ref|XP_023769659.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Lactuca sativa] gb|PLY80980.1| hypothetical protein LSAT_9X109300 [Lactuca sativa] Length = 461 Score = 53.9 bits (128), Expect(2) = 8e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIPI++G + FDV DK DVV+ AFG Sbjct: 145 IIHNPTVNKRLEEMEVKDIPIEEGEKQFDVVDKGDVVILPAFG 187 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+LTLSN+ + VD TC Sbjct: 189 AVDEMLTLSNKQVQIVDTTC 208 >gb|OAY84506.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Ananas comosus] Length = 474 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVK+IP+KDGV+ FDV DK DVV+ AFG Sbjct: 158 VIHNPTVNKRLEEMEVKNIPVKDGVKQFDVVDKGDVVILPAFG 200 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+ TLS + + VD TC Sbjct: 202 AVDEMFTLSEKKVQIVDTTC 221 >ref|XP_020104485.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Ananas comosus] Length = 469 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVK+IP+KDGV+ FDV DK DVV+ AFG Sbjct: 153 VIHNPTVNKRLEEMEVKNIPVKDGVKQFDVVDKGDVVILPAFG 195 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+ TLS + + VD TC Sbjct: 197 AVDEMFTLSEKKVQIVDTTC 216 >gb|OAY84500.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Ananas comosus] Length = 469 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVK+IP+KDGV+ FDV DK DVV+ AFG Sbjct: 153 VIHNPTVNKRLEEMEVKNIPVKDGVKQFDVVDKGDVVILPAFG 195 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+ TLS + + VD TC Sbjct: 197 AVDEMFTLSEKKVQIVDTTC 216 >ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 465 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RL EMEVKDIPI DG + F+V DK DVV+ AFG Sbjct: 149 IIHNPTVNQRLAEMEVKDIPIDDGQKQFEVVDKGDVVILPAFG 191 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATCF*ALGISFIWYVI 240 AV+E+LTLSN+++ VD TC +S +W ++ Sbjct: 193 AVDEMLTLSNKNVQIVDTTC---PWVSKVWNIV 222 >emb|CBI32545.3| unnamed protein product, partial [Vitis vinifera] Length = 380 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RL EMEVKDIPI DG + F+V DK DVV+ AFG Sbjct: 64 IIHNPTVNQRLAEMEVKDIPIDDGQKQFEVVDKGDVVILPAFG 106 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATCF*ALGISFIWYVI 240 AV+E+LTLSN+++ VD TC +S +W ++ Sbjct: 108 AVDEMLTLSNKNVQIVDTTC---PWVSKVWNIV 137 >ref|XP_020241009.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Asparagus officinalis] gb|ONK60172.1| uncharacterized protein A4U43_C08F15160 [Asparagus officinalis] Length = 462 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEM+VK+IPI+DG + FDV DKDDVVV AFG Sbjct: 146 IIHNPTVNKRLEEMDVKNIPIEDGQKQFDVVDKDDVVVLPAFG 188 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+ TLS +++ VD TC Sbjct: 190 AVDEMFTLSQKNVQIVDTTC 209 >gb|OTF90929.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helianthus annuus] Length = 467 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIP+++G + FDV ++ DVV+ AFG Sbjct: 142 IIHNPTVNKRLEEMEVKDIPVENGEKQFDVVNEGDVVILPAFG 184 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 186 AVNEMLTLSNKQVQIVDTTC 205 >gb|AMB19713.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 3 [Taraxacum kok-saghyz] Length = 461 Score = 53.9 bits (128), Expect(2) = 4e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIPI++G + FDV DK DVV+ AFG Sbjct: 145 IIHNPTVNKRLEEMEVKDIPIEEGEKQFDVVDKGDVVILPAFG 187 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AV+E+LTLS + + VD TC Sbjct: 189 AVDEMLTLSKKQVQIVDTTC 208 >ref|XP_022016966.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Helianthus annuus] ref|XP_022016967.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Helianthus annuus] Length = 458 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = +2 Query: 11 LLFQPFMMSRLEEMEVKDIPIKDGVEHFDVTDKDDVVVSLAFG 139 ++ P + RLEEMEVKDIP+++G + FDV ++ DVV+ AFG Sbjct: 142 IIHNPTVNKRLEEMEVKDIPVENGEKQFDVVNEGDVVILPAFG 184 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 142 AVNEILTLSNESL*KVDATC 201 AVNE+LTLSN+ + VD TC Sbjct: 186 AVNEMLTLSNKQVQIVDTTC 205