BLASTX nr result
ID: Chrysanthemum21_contig00022667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022667 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022735432.1| uncharacterized protein LOC111288700 isoform... 56 2e-06 ref|XP_022735431.1| uncharacterized protein LOC111288700 isoform... 56 2e-06 ref|XP_022735428.1| protein furry homolog isoform X1 [Durio zibe... 56 2e-06 gb|OMO80204.1| protein furry-like protein [Corchorus olitorius] 53 2e-06 ref|XP_023928303.1| uncharacterized protein LOC112039653 [Quercu... 53 3e-06 ref|XP_019240809.1| PREDICTED: uncharacterized protein LOC109220... 53 3e-06 ref|XP_022844761.1| uncharacterized protein LOC111367894 [Olea e... 53 4e-06 >ref|XP_022735432.1| uncharacterized protein LOC111288700 isoform X3 [Durio zibethinus] Length = 2111 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+HIE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRHIETAQAQD 33 >ref|XP_022735431.1| uncharacterized protein LOC111288700 isoform X2 [Durio zibethinus] Length = 2125 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+HIE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRHIETAQAQD 33 >ref|XP_022735428.1| protein furry homolog isoform X1 [Durio zibethinus] ref|XP_022735429.1| protein furry homolog isoform X1 [Durio zibethinus] ref|XP_022735430.1| protein furry homolog isoform X1 [Durio zibethinus] Length = 2149 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+HIE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRHIETAQAQD 33 >gb|OMO80204.1| protein furry-like protein [Corchorus olitorius] Length = 99 Score = 52.8 bits (125), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+ IE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRRIETAQAQD 33 >ref|XP_023928303.1| uncharacterized protein LOC112039653 [Quercus suber] Length = 129 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+ IE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRRIETAQAQD 33 >ref|XP_019240809.1| PREDICTED: uncharacterized protein LOC109220794, partial [Nicotiana attenuata] Length = 130 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+ IE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRRIETAQAQD 33 >ref|XP_022844761.1| uncharacterized protein LOC111367894 [Olea europaea var. sylvestris] Length = 131 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 118 MKAGSAAKLIVDALLQRCFPLARQHIEAAQAQE 216 MKAGSAAKLIVDALLQR PLAR+ IE AQAQ+ Sbjct: 1 MKAGSAAKLIVDALLQRFLPLARRRIETAQAQD 33