BLASTX nr result
ID: Chrysanthemum21_contig00022613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022613 (1138 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR38517.1| cellulose synthase, partial [Populus alba] 61 9e-09 gb|AFR38178.1| cellulose synthase, partial [Populus alba] 61 1e-08 gb|AFR38516.1| cellulose synthase, partial [Populus alba] 61 1e-08 gb|AFR38179.1| cellulose synthase, partial [Populus alba] 61 1e-08 gb|AFR38167.1| cellulose synthase, partial [Populus trichocarpa] 61 1e-08 gb|AFR38165.1| cellulose synthase, partial [Populus trichocarpa]... 61 1e-08 gb|AFR38499.1| cellulose synthase, partial [Populus trichocarpa]... 61 1e-08 gb|AFR38518.1| cellulose synthase, partial [Populus alba] 60 2e-08 gb|AFR38514.1| cellulose synthase, partial [Populus alba] 60 2e-08 gb|AFR38530.1| cellulose synthase, partial [Populus nigra] 60 4e-08 gb|AFR38525.1| cellulose synthase, partial [Populus nigra] >gi|4... 60 4e-08 gb|AFR38519.1| cellulose synthase, partial [Populus fremontii] >... 60 4e-08 gb|AFR38515.1| cellulose synthase, partial [Populus alba] 59 6e-08 gb|AFR38875.1| cellulose synthase, partial [Populus nigra] >gi|4... 59 4e-07 gb|AFR38868.1| cellulose synthase, partial [Populus nigra] >gi|4... 59 4e-07 gb|AFR38850.1| cellulose synthase, partial [Populus alba] >gi|40... 59 4e-07 gb|AFR38838.1| cellulose synthase, partial [Populus trichocarpa]... 59 4e-07 gb|PNX63254.1| cellulose synthase A catalytic subunit 1, partial... 59 7e-07 gb|ABO42587.1| putative cellulose synthase, partial [Cissampelop... 61 7e-07 gb|AAX49508.1| cellulose synthase, partial [Larix gmelinii var. ... 61 7e-07 >gb|AFR38517.1| cellulose synthase, partial [Populus alba] Length = 46 Score = 61.2 bits (147), Expect = 9e-09 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 13 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 44 >gb|AFR38178.1| cellulose synthase, partial [Populus alba] Length = 48 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 15 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 46 >gb|AFR38516.1| cellulose synthase, partial [Populus alba] Length = 53 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 20 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 51 >gb|AFR38179.1| cellulose synthase, partial [Populus alba] Length = 53 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 20 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 51 >gb|AFR38167.1| cellulose synthase, partial [Populus trichocarpa] Length = 54 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 21 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 52 >gb|AFR38165.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38166.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38168.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38169.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38170.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38171.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38172.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38173.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38174.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38175.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38176.1| cellulose synthase, partial [Populus alba] gb|AFR38177.1| cellulose synthase, partial [Populus alba] gb|AFR38180.1| cellulose synthase, partial [Populus alba] gb|AFR38181.1| cellulose synthase, partial [Populus fremontii] gb|AFR38182.1| cellulose synthase, partial [Populus fremontii] gb|AFR38183.1| cellulose synthase, partial [Populus fremontii] gb|AFR38184.1| cellulose synthase, partial [Populus fremontii] gb|AFR38185.1| cellulose synthase, partial [Populus fremontii] gb|AFR38186.1| cellulose synthase, partial [Populus fremontii] gb|AFR38187.1| cellulose synthase, partial [Populus nigra] gb|AFR38188.1| cellulose synthase, partial [Populus nigra] gb|AFR38189.1| cellulose synthase, partial [Populus nigra] gb|AFR38190.1| cellulose synthase, partial [Populus nigra] gb|AFR38191.1| cellulose synthase, partial [Populus nigra] gb|AFR38192.1| cellulose synthase, partial [Populus nigra] gb|AFR38193.1| cellulose synthase, partial [Populus nigra] Length = 54 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 21 LVAKAQKTPDEGWTMQDGTPWPGNNTRDHPGM 52 >gb|AFR38499.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38500.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38501.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38502.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38503.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38504.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38505.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38506.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38507.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38508.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38509.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38510.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38511.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38512.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38513.1| cellulose synthase, partial [Populus trichocarpa] Length = 55 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 22 LVAKAQKTPEEGWTMQDGTPWPGNNTRDHPGM 53 >gb|AFR38518.1| cellulose synthase, partial [Populus alba] Length = 55 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT HPGM Sbjct: 22 LVAKAQKTPDEGWTMQDGTPWPGNNTXDHPGM 53 >gb|AFR38514.1| cellulose synthase, partial [Populus alba] Length = 46 Score = 60.1 bits (144), Expect = 2e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT HPGM Sbjct: 13 LVAKAQKTPDEGWXMQDGTPWPGNNTXDHPGM 44 >gb|AFR38530.1| cellulose synthase, partial [Populus nigra] Length = 52 Score = 59.7 bits (143), Expect = 4e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNN++ HPGM Sbjct: 19 LVAKAQKTPEEGWTMQDGTPWPGNNSRDHPGM 50 >gb|AFR38525.1| cellulose synthase, partial [Populus nigra] gb|AFR38534.1| cellulose synthase, partial [Populus nigra] Length = 53 Score = 59.7 bits (143), Expect = 4e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNN++ HPGM Sbjct: 20 LVAKAQKTPEEGWTMQDGTPWPGNNSRDHPGM 51 >gb|AFR38519.1| cellulose synthase, partial [Populus fremontii] gb|AFR38520.1| cellulose synthase, partial [Populus fremontii] gb|AFR38521.1| cellulose synthase, partial [Populus fremontii] gb|AFR38522.1| cellulose synthase, partial [Populus fremontii] gb|AFR38523.1| cellulose synthase, partial [Populus fremontii] gb|AFR38524.1| cellulose synthase, partial [Populus fremontii] gb|AFR38526.1| cellulose synthase, partial [Populus nigra] gb|AFR38527.1| cellulose synthase, partial [Populus nigra] gb|AFR38528.1| cellulose synthase, partial [Populus nigra] gb|AFR38529.1| cellulose synthase, partial [Populus nigra] gb|AFR38531.1| cellulose synthase, partial [Populus nigra] gb|AFR38532.1| cellulose synthase, partial [Populus nigra] gb|AFR38533.1| cellulose synthase, partial [Populus nigra] gb|AFR38535.1| cellulose synthase, partial [Populus nigra] gb|AFR38536.1| cellulose synthase, partial [Populus nigra] Length = 55 Score = 59.7 bits (143), Expect = 4e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNN++ HPGM Sbjct: 22 LVAKAQKTPEEGWTMQDGTPWPGNNSRDHPGM 53 >gb|AFR38515.1| cellulose synthase, partial [Populus alba] Length = 46 Score = 58.9 bits (141), Expect = 6e-08 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW M D TPWPGNNT+ HPGM Sbjct: 13 LVAKAQKTPDEGWTMXDGTPWPGNNTRDHPGM 44 >gb|AFR38875.1| cellulose synthase, partial [Populus nigra] gb|AFR38877.1| cellulose synthase, partial [Populus nigra] Length = 141 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 1045 AKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 AKAQK PT GW MQD TPWPGNNT+ HPGM Sbjct: 1 AKAQKVPTEGWIMQDGTPWPGNNTRDHPGM 30 >gb|AFR38868.1| cellulose synthase, partial [Populus nigra] gb|AFR38870.1| cellulose synthase, partial [Populus nigra] gb|AFR38874.1| cellulose synthase, partial [Populus nigra] gb|AFR38876.1| cellulose synthase, partial [Populus nigra] Length = 141 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 1045 AKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 AKAQK PT GW MQD TPWPGNNT+ HPGM Sbjct: 1 AKAQKVPTEGWIMQDGTPWPGNNTRDHPGM 30 >gb|AFR38850.1| cellulose synthase, partial [Populus alba] gb|AFR38851.1| cellulose synthase, partial [Populus alba] gb|AFR38852.1| cellulose synthase, partial [Populus alba] gb|AFR38853.1| cellulose synthase, partial [Populus alba] Length = 141 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 1045 AKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 AKAQK PT GW MQD TPWPGNNT+ HPGM Sbjct: 1 AKAQKVPTEGWIMQDGTPWPGNNTRDHPGM 30 >gb|AFR38838.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38839.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38840.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38841.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38842.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38843.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38844.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38845.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38846.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38847.1| cellulose synthase, partial [Populus trichocarpa] gb|AFR38859.1| cellulose synthase, partial [Populus fremontii] gb|AFR38860.1| cellulose synthase, partial [Populus fremontii] gb|AFR38862.1| cellulose synthase, partial [Populus fremontii] gb|AFR38869.1| cellulose synthase, partial [Populus nigra] gb|AFR38871.1| cellulose synthase, partial [Populus nigra] gb|AFR38872.1| cellulose synthase, partial [Populus nigra] gb|AFR38873.1| cellulose synthase, partial [Populus nigra] gb|AFR38878.1| cellulose synthase, partial [Populus nigra] gb|AFR38879.1| cellulose synthase, partial [Populus nigra] gb|AFR38880.1| cellulose synthase, partial [Populus nigra] gb|AFR38881.1| cellulose synthase, partial [Populus nigra] Length = 141 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 1045 AKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 AKAQK PT GW MQD TPWPGNNT+ HPGM Sbjct: 1 AKAQKVPTEGWIMQDGTPWPGNNTRDHPGM 30 >gb|PNX63254.1| cellulose synthase A catalytic subunit 1, partial [Trifolium pratense] Length = 145 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 1042 LAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 +AKAQKTP GW MQD TPWPGNN++ HPGM Sbjct: 11 VAKAQKTPEEGWTMQDGTPWPGNNSRDHPGM 41 >gb|ABO42587.1| putative cellulose synthase, partial [Cissampelopsis volubilis] Length = 273 Score = 61.2 bits (147), Expect = 7e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 192 LVAKAQKTPEEGWTMQDGTPWPGNNTRDHPGM 223 >gb|AAX49508.1| cellulose synthase, partial [Larix gmelinii var. principis-rupprechtii] Length = 275 Score = 61.2 bits (147), Expect = 7e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 1039 ILAKAQKTPTNGWNMQDETPWPGNNTQGHPGM 1134 ++AKAQKTP GW MQD TPWPGNNT+ HPGM Sbjct: 166 LVAKAQKTPEEGWTMQDGTPWPGNNTRDHPGM 197