BLASTX nr result
ID: Chrysanthemum21_contig00022504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022504 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847817.1| PREDICTED: uncharacterized protein LOC105967... 79 1e-13 ref|XP_010671351.1| PREDICTED: uncharacterized protein LOC104888... 78 2e-13 gb|OTG10771.1| putative ribonuclease H-like domain, GAG-pre-inte... 67 2e-10 ref|XP_021980848.1| uncharacterized protein LOC110876998 [Helian... 67 4e-10 ref|XP_021320624.1| uncharacterized protein LOC110437007 [Sorghu... 67 1e-09 ref|XP_021975180.1| uncharacterized protein LOC110870301 [Helian... 65 1e-09 ref|XP_010233414.1| PREDICTED: uncharacterized protein LOC104583... 67 1e-09 ref|XP_020153198.1| uncharacterized protein LOC109738517 [Aegilo... 66 4e-09 ref|XP_021757479.1| uncharacterized protein LOC110722517 [Chenop... 66 4e-09 ref|XP_020195864.1| uncharacterized protein LOC109781680 [Aegilo... 66 4e-09 gb|OTG20115.1| putative ribonuclease H-like domain, GAG-pre-inte... 65 6e-09 ref|XP_015162132.1| PREDICTED: putative uncharacterized protein ... 65 6e-09 ref|XP_022031008.1| uncharacterized protein LOC110931947 [Helian... 65 7e-09 ref|XP_020191693.1| uncharacterized protein LOC109777471 [Aegilo... 65 1e-08 gb|AEJ07955.1| putative polyprotein [Sorghum propinquum] 65 1e-08 ref|XP_020195868.1| uncharacterized protein LOC109781683 [Aegilo... 65 1e-08 ref|XP_020186207.1| uncharacterized protein LOC109771919 [Aegilo... 65 1e-08 ref|XP_022036786.1| uncharacterized protein LOC110939536 [Helian... 64 1e-08 ref|XP_022032186.1| uncharacterized protein LOC110933264 [Helian... 64 1e-08 gb|OTF97574.1| putative protein kinase-like domain-containing pr... 64 1e-08 >ref|XP_012847817.1| PREDICTED: uncharacterized protein LOC105967747 [Erythranthe guttata] Length = 510 Score = 79.0 bits (193), Expect = 1e-13 Identities = 38/68 (55%), Positives = 48/68 (70%), Gaps = 6/68 (8%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQH------TWHQRLGHPGSEVLRR 26 +VKD TR V+LRC+S+GDLYP+ APSP P A + H TWH+RLGHPG+ V+ R Sbjct: 377 SVKDLHTRAVILRCNSSGDLYPIGAPSPSPSATALLAHTTPVSSTWHRRLGHPGNPVMTR 436 Query: 25 LVSNNSIS 2 L S+N IS Sbjct: 437 LFSSNFIS 444 >ref|XP_010671351.1| PREDICTED: uncharacterized protein LOC104888165 [Beta vulgaris subsp. vulgaris] Length = 433 Score = 77.8 bits (190), Expect = 2e-13 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -1 Query: 184 VKDFMTRRVLLRCDSTGDLYPVTAPSPIPQAL-LVSQHTWHQRLGHPGSEVLRRLVSNNS 8 VKD +T ++LRCDSTGDLYP+++P P QA +S TWH RLGHPG+ +L L SNN Sbjct: 326 VKDLLTGTIILRCDSTGDLYPISSPVPPAQAFAAISTTTWHNRLGHPGAPILNSLKSNNV 385 Query: 7 IS 2 IS Sbjct: 386 IS 387 >gb|OTG10771.1| putative ribonuclease H-like domain, GAG-pre-integrase domain protein [Helianthus annuus] Length = 175 Score = 67.0 bits (162), Expect = 2e-10 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 5/58 (8%) Frame = -1 Query: 181 KDFMTRRVLLRCDSTGDLYPVTAPSPIPQA-----LLVSQHTWHQRLGHPGSEVLRRL 23 KD TR +LRC+STGDLYP+T P P+P + V Q WHQRLGHPG +L+ L Sbjct: 3 KDLKTRAPILRCNSTGDLYPLTEPLPLPSTQPSAFVAVPQDRWHQRLGHPGKHLLQSL 60 >ref|XP_021980848.1| uncharacterized protein LOC110876998 [Helianthus annuus] Length = 253 Score = 67.4 bits (163), Expect = 4e-10 Identities = 34/59 (57%), Positives = 41/59 (69%), Gaps = 5/59 (8%) Frame = -1 Query: 184 VKDFMTRRVLLRCDSTGDLYPVTAPSPI----PQAL-LVSQHTWHQRLGHPGSEVLRRL 23 VKD TR LLRC+STGDLYP+T P P+ PQA +SQ WHQR GHPG+ +L+ L Sbjct: 189 VKDLKTRAPLLRCNSTGDLYPLTEPLPLNLSQPQAFATISQDRWHQRPGHPGNNLLQSL 247 >ref|XP_021320624.1| uncharacterized protein LOC110437007 [Sorghum bicolor] Length = 997 Score = 67.4 bits (163), Expect = 1e-09 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 2/64 (3%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLV--SQHTWHQRLGHPGSEVLRRLVSN 14 +VKD +RR ++RCDS+G LYP+ SP ALL S WHQRLGHPG EVL RLV Sbjct: 618 SVKDLHSRREIVRCDSSGPLYPLEF-SPSASALLATTSSSLWHQRLGHPGHEVLSRLVQT 676 Query: 13 NSIS 2 ++IS Sbjct: 677 SAIS 680 >ref|XP_021975180.1| uncharacterized protein LOC110870301 [Helianthus annuus] Length = 194 Score = 65.1 bits (157), Expect = 1e-09 Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 5/66 (7%) Frame = -1 Query: 184 VKDFMTRRVLLRCDSTGDLYPVTA----PSPIPQALL-VSQHTWHQRLGHPGSEVLRRLV 20 VKD T+ +LRC+S+GDLYP+T PS P AL +SQ WHQRLGHPG +L L Sbjct: 120 VKDLKTKAPILRCNSSGDLYPLTTNFIKPSTSPTALTAISQERWHQRLGHPGINILHSLK 179 Query: 19 SNNSIS 2 ++ IS Sbjct: 180 LSSFIS 185 >ref|XP_010233414.1| PREDICTED: uncharacterized protein LOC104583276 [Brachypodium distachyon] Length = 592 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHTWHQRLGHPGSEVLRRLVSNNS 8 +VKD T V+LRC S+GDLYPVT A+ WH+RLGHPG + RRLVS++S Sbjct: 460 SVKDLRTGAVILRCSSSGDLYPVTTLPHALTAVTADSTLWHRRLGHPGPDAFRRLVSSSS 519 Query: 7 I 5 + Sbjct: 520 L 520 >ref|XP_020153198.1| uncharacterized protein LOC109738517 [Aegilops tauschii subsp. tauschii] Length = 575 Score = 65.9 bits (159), Expect = 4e-09 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT---WHQRLGHPGSEVLRRLVS 17 +VKD TR V+LRCDS GDLYPV PS + T WHQRLGHPG+ LR + + Sbjct: 153 SVKDLRTRVVILRCDSDGDLYPVVRPSVHSPGIFAGAATTDLWHQRLGHPGAAALRTVAA 212 Query: 16 NNSI 5 + S+ Sbjct: 213 DQSL 216 >ref|XP_021757479.1| uncharacterized protein LOC110722517 [Chenopodium quinoa] Length = 640 Score = 65.9 bits (159), Expect = 4e-09 Identities = 34/64 (53%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIP--QALLVSQHTWHQRLGHPGSEVLRRLVSN 14 TVKD T RV+ RC++TGDLYP+T+ SP L + WH RLGHPG L L SN Sbjct: 437 TVKDLRTARVITRCNNTGDLYPITSSSPSTCLATTLTAVTPWHDRLGHPGVSSLSFLRSN 496 Query: 13 NSIS 2 N IS Sbjct: 497 NLIS 500 >ref|XP_020195864.1| uncharacterized protein LOC109781680 [Aegilops tauschii subsp. tauschii] Length = 999 Score = 65.9 bits (159), Expect = 4e-09 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT---WHQRLGHPGSEVLRRLVS 17 +VKD TR V+LRCDS GDLYPV PS + T WHQRLGHPG+ LR + + Sbjct: 522 SVKDLRTRVVILRCDSDGDLYPVVRPSVHSPGIFAGAATTDLWHQRLGHPGAAALRTVAA 581 Query: 16 NNSI 5 + S+ Sbjct: 582 DQSL 585 >gb|OTG20115.1| putative ribonuclease H-like domain, GAG-pre-integrase domain protein [Helianthus annuus] Length = 1084 Score = 65.5 bits (158), Expect = 6e-09 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = -1 Query: 181 KDFMTRRVLLRCDSTGDLYPVTAPSPI----PQALLV-SQHTWHQRLGHPGSEVLRRL 23 +D TR LLRC+STGDLYP+T P P+ PQA SQ WHQRLGHPG+ +L+ L Sbjct: 454 QDLKTRAPLLRCNSTGDLYPLTKPLPLNLSQPQAFATNSQDHWHQRLGHPGNNLLQSL 511 >ref|XP_015162132.1| PREDICTED: putative uncharacterized protein DDB_G0284695 [Solanum tuberosum] Length = 310 Score = 64.7 bits (156), Expect = 6e-09 Identities = 38/109 (34%), Positives = 51/109 (46%), Gaps = 5/109 (4%) Frame = -1 Query: 322 GHMDKSHISPGPMYYHNPVHYTGPISQVTPSSGFGYSTPGAWNMD----TVKDFMTRRVL 155 GH S P + +N +H + + F D TVKDF T R + Sbjct: 202 GHTKLSSPCPPLQFINNVLHAPHLVKNLVSVRKFTTDNSVFVEFDPCGFTVKDFQTGRPV 261 Query: 154 LRCDSTGDLYPVTAPSPIPQALLV-SQHTWHQRLGHPGSEVLRRLVSNN 11 +RC+S G+LYP+T P+ P + V + WH RLGHP VL L NN Sbjct: 262 MRCESRGELYPITTPTTSPSSFAVLAPSLWHDRLGHPRRPVLNSLRKNN 310 >ref|XP_022031008.1| uncharacterized protein LOC110931947 [Helianthus annuus] Length = 621 Score = 65.1 bits (157), Expect = 7e-09 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQA---LLVSQHTWHQRLGHPGSEVLRRL 23 TVKD T+ +LRC+S+GDLYP+TAP P + SQ WHQRLGHPG+ +L L Sbjct: 499 TVKDLKTKAPILRCNSSGDLYPLTAPLPSNTSTAFAATSQDRWHQRLGHPGASLLHSL 556 >ref|XP_020191693.1| uncharacterized protein LOC109777471 [Aegilops tauschii subsp. tauschii] ref|XP_020192750.1| uncharacterized protein LOC109778592 [Aegilops tauschii subsp. tauschii] Length = 768 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT---WHQRLGHPGSEVLRRLVS 17 +VKD TR V+LRCDS GDLYPV PS + T WHQRLGHPG+ LR + Sbjct: 330 SVKDLRTRVVILRCDSDGDLYPVVRPSVHSPGIFAGAATTDLWHQRLGHPGAAALRTVAV 389 Query: 16 NNSI 5 + S+ Sbjct: 390 DQSL 393 >gb|AEJ07955.1| putative polyprotein [Sorghum propinquum] Length = 826 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT-WHQRLGHPGSEVLRRLVSNN 11 +VKD TR V+ RC+S+GDLYP P+ ALL + + WH+RLGH G E L +LVS++ Sbjct: 555 SVKDLQTRNVIARCNSSGDLYPFFPPATSATALLAAPASLWHRRLGHLGREALSQLVSSS 614 Query: 10 SIS 2 +IS Sbjct: 615 AIS 617 >ref|XP_020195868.1| uncharacterized protein LOC109781683 [Aegilops tauschii subsp. tauschii] Length = 1052 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT---WHQRLGHPGSEVLRRLVS 17 +VKD TR V+LRCDS GDLYPV PS + T WHQRLGHPG+ LR + Sbjct: 533 SVKDLRTRVVILRCDSDGDLYPVVRPSVHSPGIFAGAATTDLWHQRLGHPGAAALRTVAV 592 Query: 16 NNSI 5 + S+ Sbjct: 593 DQSL 596 >ref|XP_020186207.1| uncharacterized protein LOC109771919 [Aegilops tauschii subsp. tauschii] Length = 1536 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQALLVSQHT---WHQRLGHPGSEVLRRLVS 17 +VKD TR V+LRCDS GDLYPV PS + T WHQRLGHPG+ LR + Sbjct: 533 SVKDLRTRVVILRCDSDGDLYPVVRPSVHSPGIFAGAATTDLWHQRLGHPGAAALRTVAV 592 Query: 16 NNSI 5 + S+ Sbjct: 593 DQSL 596 >ref|XP_022036786.1| uncharacterized protein LOC110939536 [Helianthus annuus] Length = 538 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQA---LLVSQHTWHQRLGHPGSEVLRRL 23 TVKD T+ LLRC+S+GDLYP+TAP P + +Q WHQRLGHPG +L L Sbjct: 438 TVKDLKTKAPLLRCNSSGDLYPLTAPLPSNTSTAFAATTQDRWHQRLGHPGDSLLHSL 495 >ref|XP_022032186.1| uncharacterized protein LOC110933264 [Helianthus annuus] Length = 578 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -1 Query: 187 TVKDFMTRRVLLRCDSTGDLYPVTAPSPIPQA---LLVSQHTWHQRLGHPGSEVLRRL 23 TVKD T+ LLRC+S+GDLYP+TAP P + +Q WHQRLGHPG +L L Sbjct: 436 TVKDLKTKAPLLRCNSSGDLYPLTAPLPSNTSTAFAATTQDRWHQRLGHPGDSLLHSL 493 >gb|OTF97574.1| putative protein kinase-like domain-containing protein [Helianthus annuus] Length = 1065 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 5/64 (7%) Frame = -1 Query: 178 DFMTRRVLLRCDSTGDLYPVTAPSPIPQA-----LLVSQHTWHQRLGHPGSEVLRRLVSN 14 D T+ +LRC+S+GDLYP+TAP P + +SQ WHQRLGHPG+ +L L + Sbjct: 606 DLKTKAPILRCNSSGDLYPLTAPIPTTTSSTTALAAISQDRWHQRLGHPGNSLLHSLKLS 665 Query: 13 NSIS 2 +S+S Sbjct: 666 SSVS 669