BLASTX nr result
ID: Chrysanthemum21_contig00022451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022451 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021986829.1| adenylate kinase 5, chloroplastic, partial [... 74 1e-12 gb|KVH93708.1| Adenylate kinase, partial [Cynara cardunculus var... 72 6e-12 ref|XP_022867064.1| adenylate kinase 5, chloroplastic [Olea euro... 70 3e-11 gb|KRH37891.1| hypothetical protein GLYMA_09G096800 [Glycine max... 69 4e-11 ref|XP_014617531.1| PREDICTED: adenylate kinase 5, chloroplastic... 69 5e-11 gb|KRH37890.1| hypothetical protein GLYMA_09G096800 [Glycine max] 69 5e-11 ref|XP_014617530.1| PREDICTED: adenylate kinase 5, chloroplastic... 69 5e-11 ref|XP_014617529.1| PREDICTED: adenylate kinase 5, chloroplastic... 69 5e-11 ref|XP_006495182.2| PREDICTED: adenylate kinase 5, chloroplastic... 67 1e-10 gb|KDO59358.1| hypothetical protein CISIN_1g017996mg [Citrus sin... 67 2e-10 gb|KYP56922.1| hypothetical protein KK1_003173 [Cajanus cajan] 68 2e-10 gb|KDO59356.1| hypothetical protein CISIN_1g017996mg [Citrus sin... 67 2e-10 ref|XP_020226703.1| adenylate kinase 5, chloroplastic [Cajanus c... 68 2e-10 gb|KDO59355.1| hypothetical protein CISIN_1g017996mg [Citrus sin... 67 2e-10 gb|ESR66929.1| hypothetical protein CICLE_v10007794mg [Citrus cl... 67 2e-10 gb|KJB64577.1| hypothetical protein B456_010G054600 [Gossypium r... 67 2e-10 dbj|GAU48937.1| hypothetical protein TSUD_373460 [Trifolium subt... 67 2e-10 ref|XP_006473952.1| PREDICTED: adenylate kinase 5, chloroplastic... 67 2e-10 gb|ESR66930.1| hypothetical protein CICLE_v10007794mg [Citrus cl... 67 2e-10 ref|XP_024034445.1| adenylate kinase 5, chloroplastic isoform X4... 67 2e-10 >ref|XP_021986829.1| adenylate kinase 5, chloroplastic, partial [Helianthus annuus] Length = 498 Score = 73.9 bits (180), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPEQ 414 REYFYDDVLQATQRAINDGK RVKVEINIPELNPEQ Sbjct: 336 REYFYDDVLQATQRAINDGKTRVKVEINIPELNPEQ 371 >gb|KVH93708.1| Adenylate kinase, partial [Cynara cardunculus var. scolymus] Length = 632 Score = 72.0 bits (175), Expect = 6e-12 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 REYFYDDVLQATQRAINDGK RVKVEINIPELNPE Sbjct: 363 REYFYDDVLQATQRAINDGKTRVKVEINIPELNPE 397 >ref|XP_022867064.1| adenylate kinase 5, chloroplastic [Olea europaea var. sylvestris] Length = 590 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 REYFYDDVLQATQRAINDGK ++KVEINIPELNPE Sbjct: 330 REYFYDDVLQATQRAINDGKTQIKVEINIPELNPE 364 >gb|KRH37891.1| hypothetical protein GLYMA_09G096800 [Glycine max] gb|KRH37892.1| hypothetical protein GLYMA_09G096800 [Glycine max] Length = 354 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRAINDGK RVKV+INIPELNPE Sbjct: 87 RKYFYDDVLQATQRAINDGKTRVKVDINIPELNPE 121 >ref|XP_014617531.1| PREDICTED: adenylate kinase 5, chloroplastic-like isoform X3 [Glycine max] Length = 454 Score = 69.3 bits (168), Expect = 5e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRAINDGK RVKV+INIPELNPE Sbjct: 187 RKYFYDDVLQATQRAINDGKTRVKVDINIPELNPE 221 >gb|KRH37890.1| hypothetical protein GLYMA_09G096800 [Glycine max] Length = 468 Score = 69.3 bits (168), Expect = 5e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRAINDGK RVKV+INIPELNPE Sbjct: 201 RKYFYDDVLQATQRAINDGKTRVKVDINIPELNPE 235 >ref|XP_014617530.1| PREDICTED: adenylate kinase 5, chloroplastic-like isoform X2 [Glycine max] gb|KHN42485.1| Adenylate kinase, chloroplastic [Glycine soja] gb|KRH37889.1| hypothetical protein GLYMA_09G096800 [Glycine max] Length = 597 Score = 69.3 bits (168), Expect = 5e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRAINDGK RVKV+INIPELNPE Sbjct: 330 RKYFYDDVLQATQRAINDGKTRVKVDINIPELNPE 364 >ref|XP_014617529.1| PREDICTED: adenylate kinase 5, chloroplastic-like isoform X1 [Glycine max] Length = 598 Score = 69.3 bits (168), Expect = 5e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRAINDGK RVKV+INIPELNPE Sbjct: 331 RKYFYDDVLQATQRAINDGKTRVKVDINIPELNPE 365 >ref|XP_006495182.2| PREDICTED: adenylate kinase 5, chloroplastic-like [Citrus sinensis] Length = 263 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 87 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 121 >gb|KDO59358.1| hypothetical protein CISIN_1g017996mg [Citrus sinensis] Length = 311 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 44 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 78 >gb|KYP56922.1| hypothetical protein KK1_003173 [Cajanus cajan] Length = 421 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRA+NDGK R+KV+INIPELNPE Sbjct: 152 RKYFYDDVLQATQRAVNDGKTRLKVDINIPELNPE 186 >gb|KDO59356.1| hypothetical protein CISIN_1g017996mg [Citrus sinensis] gb|KDO59357.1| hypothetical protein CISIN_1g017996mg [Citrus sinensis] Length = 328 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 61 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 95 >ref|XP_020226703.1| adenylate kinase 5, chloroplastic [Cajanus cajan] Length = 590 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVLQATQRA+NDGK R+KV+INIPELNPE Sbjct: 323 RKYFYDDVLQATQRAVNDGKTRLKVDINIPELNPE 357 >gb|KDO59355.1| hypothetical protein CISIN_1g017996mg [Citrus sinensis] Length = 362 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 61 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 95 >gb|ESR66929.1| hypothetical protein CICLE_v10007794mg [Citrus clementina] gb|ESR66931.1| hypothetical protein CICLE_v10007794mg [Citrus clementina] gb|ESR66932.1| hypothetical protein CICLE_v10007794mg [Citrus clementina] Length = 455 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 188 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 222 >gb|KJB64577.1| hypothetical protein B456_010G054600 [Gossypium raimondii] Length = 467 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 200 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 234 >dbj|GAU48937.1| hypothetical protein TSUD_373460 [Trifolium subterraneum] Length = 490 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R+YFYDDVL ATQRAINDGKIR+KV+INIPELNPE Sbjct: 317 RKYFYDDVLLATQRAINDGKIRLKVDINIPELNPE 351 >ref|XP_006473952.1| PREDICTED: adenylate kinase 5, chloroplastic isoform X2 [Citrus sinensis] Length = 504 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 237 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 271 >gb|ESR66930.1| hypothetical protein CICLE_v10007794mg [Citrus clementina] Length = 504 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 237 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 271 >ref|XP_024034445.1| adenylate kinase 5, chloroplastic isoform X4 [Citrus clementina] ref|XP_024034446.1| adenylate kinase 5, chloroplastic isoform X4 [Citrus clementina] Length = 505 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 307 REYFYDDVLQATQRAINDGKIRVKVEINIPELNPE 411 R YFYDDVLQATQRA+NDG+ R+KVEINIPELNPE Sbjct: 237 RNYFYDDVLQATQRAVNDGRTRLKVEINIPELNPE 271