BLASTX nr result
ID: Chrysanthemum21_contig00022075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022075 (617 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021996462.1| AMSH-like ubiquitin thioesterase 1 [Helianth... 58 2e-06 >ref|XP_021996462.1| AMSH-like ubiquitin thioesterase 1 [Helianthus annuus] ref|XP_021996463.1| AMSH-like ubiquitin thioesterase 1 [Helianthus annuus] gb|OTG03696.1| putative associated molecule with the SH3 domain of STAM 1 [Helianthus annuus] Length = 516 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 5 MEEQTRQLSLNIPRATEESLSRHSILGPNGLF 100 ++EQTRQLS+NIPRA EE+LSRHSILGPNGL+ Sbjct: 177 LDEQTRQLSVNIPRAKEETLSRHSILGPNGLY 208