BLASTX nr result
ID: Chrysanthemum21_contig00022049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00022049 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023773047.1| uncharacterized protein LOC111921692 [Lactuc... 61 1e-07 >ref|XP_023773047.1| uncharacterized protein LOC111921692 [Lactuca sativa] gb|PLY78385.1| hypothetical protein LSAT_9X8080 [Lactuca sativa] Length = 382 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 3 PISDPKDPILVDDFEEVGAIPEEEKSEEAVKQWEPVEIKPKAP 131 PISDPKDPIL+D+FE +G +E EE +K+WEP+EIKPK P Sbjct: 326 PISDPKDPILMDEFEVIGGATKE---EEGLKEWEPLEIKPKVP 365