BLASTX nr result
ID: Chrysanthemum21_contig00021327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00021327 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH97856.1| AAA+ ATPase domain-containing protein [Cynara car... 57 3e-06 ref|XP_004504465.1| PREDICTED: putative pre-mRNA-splicing factor... 57 3e-06 gb|PNY04084.1| ATP-dependent RNA helicase dhx8-like protein [Tri... 55 6e-06 dbj|GAU30239.1| hypothetical protein TSUD_67910 [Trifolium subte... 55 9e-06 >gb|KVH97856.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 656 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 472 QPEEKTTENSDVPKKNVKTAEPADDAKSRIQAARERFLARKGNK 341 Q EEKTT NSD PKK P DD+ SRIQAARERFLARK NK Sbjct: 617 QSEEKTTVNSDFPKK----VGPIDDSSSRIQAARERFLARKTNK 656 >ref|XP_004504465.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 [Cicer arietinum] Length = 697 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 466 EEKTTENSDVPKKNVKTAEPADDAKSRIQAARERFLARKGNK 341 EE D+PK+NV+ A ADD++SRIQAARERFLARKGNK Sbjct: 656 EEPEKSIPDLPKQNVEVAVAADDSQSRIQAARERFLARKGNK 697 >gb|PNY04084.1| ATP-dependent RNA helicase dhx8-like protein [Trifolium pratense] Length = 276 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 466 EEKTTENSDVPKKNVKTAEPADDAKSRIQAARERFLARKGNK 341 EE D+PKKNV+ A DD++SRIQAARERFLARK NK Sbjct: 214 EESERSIPDLPKKNVEVAAATDDSESRIQAARERFLARKANK 255 >dbj|GAU30239.1| hypothetical protein TSUD_67910 [Trifolium subterraneum] Length = 792 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 466 EEKTTENSDVPKKNVKTAEPADDAKSRIQAARERFLARKGNK 341 EE D+PKKNV+ A DD++SRIQAARERFLARK NK Sbjct: 732 EESERNIPDLPKKNVEVAASVDDSESRIQAARERFLARKANK 773