BLASTX nr result
ID: Chrysanthemum21_contig00021182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00021182 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV82543.1| Pkinase domain-containing protein [Cephalotus fo... 57 9e-07 gb|AQK84907.1| putative receptor-like protein kinase [Zea mays] 54 1e-06 ref|XP_013646449.1| probable receptor-like protein kinase At5g18... 55 1e-06 gb|ESR41536.1| hypothetical protein CICLE_v100116733mg, partial ... 56 2e-06 ref|XP_006428296.2| probable receptor-like protein kinase At5g18... 56 2e-06 gb|POF08445.1| putative receptor-like protein kinase [Quercus su... 56 2e-06 gb|KDO41830.1| hypothetical protein CISIN_1g010653mg [Citrus sin... 56 2e-06 ref|XP_023914221.1| probable receptor-like protein kinase At2g42... 56 2e-06 emb|CDY66239.1| BnaCnng50120D [Brassica napus] 56 2e-06 ref|XP_020248717.1| probable receptor-like protein kinase At2g42... 56 2e-06 gb|OAY43920.1| hypothetical protein MANES_08G108100 [Manihot esc... 56 2e-06 gb|OWM78769.1| hypothetical protein CDL15_Pgr002940 [Punica gran... 56 2e-06 ref|XP_018452202.1| PREDICTED: probable receptor-like protein ki... 56 2e-06 ref|XP_013728881.1| probable receptor-like protein kinase At5g18... 56 2e-06 ref|XP_013746345.1| probable receptor-like protein kinase At5g18... 56 2e-06 ref|XP_013613211.1| PREDICTED: probable receptor-like protein ki... 56 2e-06 ref|XP_009113370.1| PREDICTED: probable receptor-like protein ki... 56 2e-06 ref|XP_023534010.1| probable receptor-like protein kinase At2g42... 56 2e-06 ref|XP_020553025.1| LOW QUALITY PROTEIN: probable receptor-like ... 56 2e-06 ref|XP_017247932.1| PREDICTED: probable receptor-like protein ki... 56 2e-06 >dbj|GAV82543.1| Pkinase domain-containing protein [Cephalotus follicularis] Length = 505 Score = 56.6 bits (135), Expect = 9e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYANIG+L +KS+VY+FG++LLEAIT Sbjct: 347 RVMGTFGYVAPEYANIGLLNEKSDVYSFGVVLLEAIT 383 >gb|AQK84907.1| putative receptor-like protein kinase [Zea mays] Length = 151 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG++LLEAIT Sbjct: 12 RVMGTFGYVAPEYANSGLLNEKSDVYSFGVVLLEAIT 48 >ref|XP_013646449.1| probable receptor-like protein kinase At5g18500 [Brassica napus] Length = 210 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+L+LEAIT Sbjct: 61 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLILEAIT 97 >gb|ESR41536.1| hypothetical protein CICLE_v100116733mg, partial [Citrus clementina] Length = 354 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 234 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 270 >ref|XP_006428296.2| probable receptor-like protein kinase At5g18500, partial [Citrus clementina] Length = 405 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 246 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 282 >gb|POF08445.1| putative receptor-like protein kinase [Quercus suber] Length = 440 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 279 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 315 >gb|KDO41830.1| hypothetical protein CISIN_1g010653mg [Citrus sinensis] Length = 463 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 304 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 340 >ref|XP_023914221.1| probable receptor-like protein kinase At2g42960 isoform X2 [Quercus suber] Length = 480 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 319 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 355 >emb|CDY66239.1| BnaCnng50120D [Brassica napus] Length = 484 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 334 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 370 >ref|XP_020248717.1| probable receptor-like protein kinase At2g42960 [Asparagus officinalis] gb|ONK82082.1| uncharacterized protein A4U43_C01F35930 [Asparagus officinalis] Length = 487 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 329 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 365 >gb|OAY43920.1| hypothetical protein MANES_08G108100 [Manihot esculenta] Length = 495 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 337 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 373 >gb|OWM78769.1| hypothetical protein CDL15_Pgr002940 [Punica granatum] gb|PKI33639.1| hypothetical protein CRG98_045995 [Punica granatum] Length = 496 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 342 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 378 >ref|XP_018452202.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Raphanus sativus] ref|XP_018452203.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Raphanus sativus] Length = 497 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 347 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 383 >ref|XP_013728881.1| probable receptor-like protein kinase At5g18500 isoform X2 [Brassica napus] ref|XP_022548303.1| probable receptor-like protein kinase At5g18500 isoform X3 [Brassica napus] Length = 498 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 348 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 384 >ref|XP_013746345.1| probable receptor-like protein kinase At5g18500 isoform X2 [Brassica napus] Length = 498 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 348 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 384 >ref|XP_013613211.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica oleracea var. oleracea] Length = 498 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 348 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 384 >ref|XP_009113370.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform X2 [Brassica rapa] ref|XP_009113371.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform X2 [Brassica rapa] Length = 498 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 348 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 384 >ref|XP_023534010.1| probable receptor-like protein kinase At2g42960 [Cucurbita pepo subsp. pepo] Length = 499 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS++Y+FGILLLEAIT Sbjct: 344 RVMGTFGYVAPEYANTGLLNEKSDIYSFGILLLEAIT 380 >ref|XP_020553025.1| LOW QUALITY PROTEIN: probable receptor-like protein kinase At5g18500 [Sesamum indicum] Length = 503 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 347 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 383 >ref|XP_017247932.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Daucus carota subsp. sativus] Length = 503 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 113 RVM*TFGDVVPEYANIGVLIQKSNVYTFGILLLEAIT 3 RVM TFG V PEYAN G+L +KS+VY+FG+LLLEAIT Sbjct: 341 RVMGTFGYVAPEYANTGLLNEKSDVYSFGVLLLEAIT 377