BLASTX nr result
ID: Chrysanthemum21_contig00021144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00021144 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021994294.1| cyclin-dependent kinases regulatory subunit ... 68 2e-12 ref|XP_021979472.1| cyclin-dependent kinases regulatory subunit ... 67 5e-12 ref|XP_023738106.1| cyclin-dependent kinases regulatory subunit ... 67 7e-12 gb|ERN08332.1| hypothetical protein AMTR_s00276p00017590 [Ambore... 65 2e-11 gb|OTG08832.1| putative cyclin-dependent kinase, regulatory subu... 68 2e-11 ref|XP_017181109.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 gb|EPS59959.1| hypothetical protein M569_14849, partial [Genlise... 65 3e-11 ref|XP_022853105.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 ref|XP_018833026.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 ref|XP_015161426.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 ref|XP_021674552.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 ref|XP_019199486.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 ref|XP_021627149.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 ref|XP_017247035.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 ref|XP_010109923.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 ref|XP_006295341.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 gb|AAO13226.1|AF149014_1 CKS1 protein [Populus tremula x Populus... 65 3e-11 ref|XP_011028271.1| PREDICTED: cyclin-dependent kinases regulato... 65 3e-11 ref|NP_180364.1| CDK-subunit 2 [Arabidopsis thaliana] >gi|297822... 65 3e-11 ref|XP_020093446.1| cyclin-dependent kinases regulatory subunit ... 65 3e-11 >ref|XP_021994294.1| cyclin-dependent kinases regulatory subunit 1 [Helianthus annuus] Length = 90 Score = 68.2 bits (165), Expect = 2e-12 Identities = 33/44 (75%), Positives = 33/44 (75%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNYXXXXXXXXXXXQSLLAK 249 QQSRGWVHYAIHRPEPHIMLFRRPLNY QSLLAK Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQAHQSLLAK 90 >ref|XP_021979472.1| cyclin-dependent kinases regulatory subunit 1-like [Helianthus annuus] ref|XP_021979477.1| cyclin-dependent kinases regulatory subunit 1-like [Helianthus annuus] ref|XP_021979481.1| cyclin-dependent kinases regulatory subunit 1-like [Helianthus annuus] ref|XP_021979486.1| cyclin-dependent kinases regulatory subunit 1-like [Helianthus annuus] gb|OTG37497.1| putative cyclin-dependent kinases regulatory subunit 1 [Helianthus annuus] Length = 90 Score = 67.0 bits (162), Expect = 5e-12 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNYXXXXXXXXXXXQSLLAK 249 QQSRGWVHYAIHRPEPHIMLFRRPLNY Q+LLAK Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQAHQTLLAK 90 >ref|XP_023738106.1| cyclin-dependent kinases regulatory subunit 1-like [Lactuca sativa] gb|PLY70434.1| hypothetical protein LSAT_1X64981 [Lactuca sativa] Length = 90 Score = 66.6 bits (161), Expect = 7e-12 Identities = 32/44 (72%), Positives = 32/44 (72%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNYXXXXXXXXXXXQSLLAK 249 QQSRGWVHYAIHRPEPHIMLFRRPLNY Q LLAK Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQAHQGLLAK 90 >gb|ERN08332.1| hypothetical protein AMTR_s00276p00017590 [Amborella trichopoda] Length = 53 Score = 64.7 bits (156), Expect = 2e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 12 QQSRGWVHYAIHRPEPHIMLFRRPLNY 38 >gb|OTG08832.1| putative cyclin-dependent kinase, regulatory subunit [Helianthus annuus] Length = 190 Score = 68.2 bits (165), Expect = 2e-11 Identities = 33/44 (75%), Positives = 33/44 (75%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNYXXXXXXXXXXXQSLLAK 249 QQSRGWVHYAIHRPEPHIMLFRRPLNY QSLLAK Sbjct: 147 QQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQAHQSLLAK 190 >ref|XP_017181109.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Malus domestica] Length = 76 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 35 QQSRGWVHYAIHRPEPHIMLFRRPLNY 61 >gb|EPS59959.1| hypothetical protein M569_14849, partial [Genlisea aurea] Length = 76 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 37 QQSRGWVHYAIHRPEPHIMLFRRPLNY 63 >ref|XP_022853105.1| cyclin-dependent kinases regulatory subunit 1-like [Olea europaea var. sylvestris] ref|XP_022853106.1| cyclin-dependent kinases regulatory subunit 1-like [Olea europaea var. sylvestris] ref|XP_022853107.1| cyclin-dependent kinases regulatory subunit 1-like [Olea europaea var. sylvestris] Length = 91 Score = 65.1 bits (157), Expect = 3e-11 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNYXXXXXXXXXXXQSLLAK 249 QQSRGWVHYAIHRPEPHIMLFRRPLNY ++++AK Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQQQENQAGENMVAK 90 >ref|XP_018833026.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like, partial [Juglans regia] Length = 79 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 QQSRGWVHYAIHRPEPHIMLFRRPLNY 64 >ref|XP_015161426.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1, partial [Solanum tuberosum] Length = 79 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_021674552.1| cyclin-dependent kinases regulatory subunit 1 [Hevea brasiliensis] ref|XP_021674553.1| cyclin-dependent kinases regulatory subunit 1 [Hevea brasiliensis] ref|XP_021674554.1| cyclin-dependent kinases regulatory subunit 1 [Hevea brasiliensis] Length = 81 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_019199486.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Ipomoea nil] Length = 81 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_021627149.1| cyclin-dependent kinases regulatory subunit 1 [Manihot esculenta] gb|OAY38103.1| hypothetical protein MANES_11G152900 [Manihot esculenta] Length = 81 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_017247035.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Daucus carota subsp. sativus] gb|KZM97137.1| hypothetical protein DCAR_015501 [Daucus carota subsp. sativus] Length = 82 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010109923.1| cyclin-dependent kinases regulatory subunit 1 [Morus notabilis] gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_006295341.1| cyclin-dependent kinases regulatory subunit 2 [Capsella rubella] gb|EOA28239.1| hypothetical protein CARUB_v10024432mg [Capsella rubella] Length = 82 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|AAO13226.1|AF149014_1 CKS1 protein [Populus tremula x Populus tremuloides] gb|ABK95998.1| unknown [Populus trichocarpa] gb|ABK96697.1| unknown [Populus trichocarpa x Populus deltoides] gb|PNT42519.1| hypothetical protein POPTR_004G217500v3 [Populus trichocarpa] gb|PNT42520.1| hypothetical protein POPTR_004G217500v3 [Populus trichocarpa] Length = 83 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_011028271.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Populus euphratica] Length = 83 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|NP_180364.1| CDK-subunit 2 [Arabidopsis thaliana] ref|XP_002879124.1| cyclin-dependent kinases regulatory subunit 2 [Arabidopsis lyrata subsp. lyrata] ref|XP_020883832.1| cyclin-dependent kinases regulatory subunit 2 [Arabidopsis lyrata subsp. lyrata] sp|Q9SJJ5.1|CKS2_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 2 gb|AAD21505.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gb|AAR24151.1| At2g27970 [Arabidopsis thaliana] gb|AAR92293.1| At2g27970 [Arabidopsis thaliana] gb|EFH55383.1| cdk-subunit 2 [Arabidopsis lyrata subsp. lyrata] gb|AEC08065.1| CDK-subunit 2 [Arabidopsis thaliana] gb|OAP11293.1| CKS2 [Arabidopsis thaliana] Length = 83 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_020093446.1| cyclin-dependent kinases regulatory subunit 1 [Ananas comosus] Length = 84 Score = 64.7 bits (156), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 380 QQSRGWVHYAIHRPEPHIMLFRRPLNY 300 QQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 47 QQSRGWVHYAIHRPEPHIMLFRRPLNY 73