BLASTX nr result
ID: Chrysanthemum21_contig00020706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00020706 (893 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022008618.1| pentatricopeptide repeat-containing protein ... 59 6e-06 >ref|XP_022008618.1| pentatricopeptide repeat-containing protein At1g76280 [Helianthus annuus] ref|XP_022008620.1| pentatricopeptide repeat-containing protein At1g76280 [Helianthus annuus] gb|OTF96870.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 794 Score = 58.9 bits (141), Expect = 6e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 496 MKNLGVKPSRNAYDSLIRVLIKERGFHDVLELLNLV 603 M+ LG++PSR+AYD LIRVLIKERGFHD +E+LNL+ Sbjct: 355 MQKLGIEPSRSAYDGLIRVLIKERGFHDGIEMLNLM 390