BLASTX nr result
ID: Chrysanthemum21_contig00020412
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00020412 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001938519.1| 40S ribosomal protein S28 [Pyrenophora triti... 114 9e-31 ref|XP_001798512.1| hypothetical protein SNOG_08190 [Parastagono... 113 3e-30 ref|XP_018381678.1| ribosomal protein S28e [Alternaria alternata... 110 3e-29 gb|KZM27071.1| structural constituent of ribosome [Ascochyta rab... 110 4e-29 ref|XP_018030669.1| ribosomal protein S28e [Paraphaeosphaeria sp... 109 9e-29 ref|XP_015402063.1| 40S ribosomal protein S28, partial [Aspergil... 109 1e-28 gb|OSS54693.1| hypothetical protein B5807_00480 [Epicoccum nigrum] 108 2e-28 gb|KZL81386.1| 40s ribosomal protein s28, partial [Colletotrichu... 109 2e-28 gb|KUI56796.1| 40S ribosomal protein S28 [Valsa mali var. pyri] ... 107 5e-28 ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [... 107 5e-28 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 107 7e-28 ref|XP_020131267.1| 40s ribosomal protein s28 [Diplodia corticol... 106 1e-27 ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fi... 106 1e-27 gb|PHH84408.1| hypothetical protein CDD83_1988 [Cordyceps sp. RA... 106 1e-27 gb|KKY30575.1| putative 40s ribosomal protein s28 [Diaporthe amp... 106 1e-27 ref|XP_022583430.1| hypothetical protein ASPZODRAFT_149897 [Peni... 105 2e-27 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 105 2e-27 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 105 2e-27 gb|OCK76572.1| ribosomal protein S28e, partial [Lepidopterella p... 105 3e-27 gb|OCL01585.1| ribosomal protein S28e [Glonium stellatum] >gi|11... 105 3e-27 >ref|XP_001938519.1| 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] ref|XP_007684196.1| hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] ref|XP_007703379.1| hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] ref|XP_007714597.1| hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] ref|XP_008029697.1| hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] ref|XP_014078919.1| hypothetical protein COCC4DRAFT_138898 [Bipolaris maydis ATCC 48331] ref|XP_014555072.1| hypothetical protein COCVIDRAFT_103321 [Bipolaris victoriae FI3] gb|EDU51106.1| 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] gb|EFQ87658.1| hypothetical protein PTT_16774 [Pyrenophora teres f. teres 0-1] gb|EMD61042.1| hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] gb|EMD89273.1| hypothetical protein COCHEDRAFT_1141328 [Bipolaris maydis C5] gb|ENI05010.1| hypothetical protein COCC4DRAFT_138898 [Bipolaris maydis ATCC 48331] gb|EOA82605.1| hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] gb|EUC31086.1| hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] gb|EUC49303.1| hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] gb|EUN25495.1| hypothetical protein COCVIDRAFT_103321 [Bipolaris victoriae FI3] gb|KNG49437.1| 40s ribosomal protein s28 [Stemphylium lycopersici] Length = 68 Score = 114 bits (285), Expect = 9e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 56 >ref|XP_001798512.1| hypothetical protein SNOG_08190 [Parastagonospora nodorum SN15] ref|XP_003834465.1| hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] gb|EAT84466.1| hypothetical protein SNOG_08190 [Parastagonospora nodorum SN15] emb|CBX91100.1| hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] gb|OAL00547.1| ribosomal protein S28e [Stagonospora sp. SRC1lsM3a] gb|OAL49552.1| ribosomal protein S28e [Pyrenochaeta sp. DS3sAY3a] Length = 68 Score = 113 bits (282), Expect = 3e-30 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD+AKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC Sbjct: 1 MDTAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 56 >ref|XP_018381678.1| ribosomal protein S28e [Alternaria alternata] gb|OAG16257.1| ribosomal protein S28e [Alternaria alternata] gb|OWY47500.1| ribosomal protein S28e [Alternaria alternata] Length = 68 Score = 110 bits (275), Expect = 3e-29 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAKAPV LVKVTRVLGRTGSRGGVTQCRVEFM+DQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 56 >gb|KZM27071.1| structural constituent of ribosome [Ascochyta rabiei] Length = 68 Score = 110 bits (274), Expect = 4e-29 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD+AKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKG VRENDILC Sbjct: 1 MDTAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGAVRENDILC 56 >ref|XP_018030669.1| ribosomal protein S28e [Paraphaeosphaeria sporulosa] gb|OAG00304.1| ribosomal protein S28e [Paraphaeosphaeria sporulosa] Length = 68 Score = 109 bits (272), Expect = 9e-29 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD+AK PVKLVKVTRVLGRTGSRGGVTQCRVEFMDD TRSIIRNVKGPVRENDILC Sbjct: 1 MDTAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_015402063.1| 40S ribosomal protein S28, partial [Aspergillus nomius NRRL 13137] gb|KNG81140.1| 40S ribosomal protein S28, partial [Aspergillus nomius NRRL 13137] Length = 88 Score = 109 bits (273), Expect = 1e-28 Identities = 55/64 (85%), Positives = 59/64 (92%) Frame = +3 Query: 12 RRNSQSHKMDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREN 191 +R +QS MDSAKAPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQ+RSIIRNVKGPVR + Sbjct: 13 QRENQSFAMDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGPVRVD 72 Query: 192 DILC 203 DILC Sbjct: 73 DILC 76 >gb|OSS54693.1| hypothetical protein B5807_00480 [Epicoccum nigrum] Length = 68 Score = 108 bits (270), Expect = 2e-28 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 M++AKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKG VRENDILC Sbjct: 1 METAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGAVRENDILC 56 >gb|KZL81386.1| 40s ribosomal protein s28, partial [Colletotrichum incanum] Length = 106 Score = 109 bits (273), Expect = 2e-28 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 2/63 (3%) Frame = +3 Query: 21 SQSH--KMDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREND 194 SQ H KMDSAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+D Sbjct: 32 SQPHTFKMDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDD 91 Query: 195 ILC 203 ILC Sbjct: 92 ILC 94 >gb|KUI56796.1| 40S ribosomal protein S28 [Valsa mali var. pyri] gb|KUI71137.1| 40S ribosomal protein S28 [Valsa mali] Length = 68 Score = 107 bits (267), Expect = 5e-28 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDS+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRENDILC 56 >ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] ref|XP_014541713.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] ref|XP_018145445.1| ribosomal protein s28e domain-containing protein [Pochonia chlamydosporia 170] ref|XP_018183085.1| ribosomal protein s28e domain-containing protein [Purpureocillium lilacinum] emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gb|EON99563.1| putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] gb|KFG85603.1| 40S ribosomal protein S28 [Metarhizium anisopliae] gb|KID69986.1| Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] gb|KID72508.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gb|KID89430.1| Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] gb|KJK75639.1| hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] gb|KJK93999.1| hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] gb|KJZ75767.1| 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] gb|OAQ68595.1| ribosomal protein s28e domain-containing protein [Pochonia chlamydosporia 170] gb|OAQ94366.1| ribosomal protein s28e domain-containing protein [Purpureocillium lilacinum] gb|ODA78688.1| hypothetical protein RJ55_06070 [Drechmeria coniospora] gb|POR39238.1| putative ribosomal protein S28B [Tolypocladium paradoxum] Length = 68 Score = 107 bits (267), Expect = 5e-28 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDS+KAPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] ref|XP_020118751.1| 40S ribosomal protein S28 [Talaromyces atroroseus] gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] gb|KUL86410.1| hypothetical protein ZTR_08157 [Talaromyces verruculosus] gb|OKL58630.1| 40S ribosomal protein S28 [Talaromyces atroroseus] gb|PCG96095.1| Nucleic acid-binding, OB-fold [Penicillium occitanis] gb|PCH01127.1| hypothetical protein PENOC_049950 [Penicillium occitanis] Length = 68 Score = 107 bits (266), Expect = 7e-28 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_020131267.1| 40s ribosomal protein s28 [Diplodia corticola] ref|XP_020128951.1| 40s ribosomal protein s28 [Diplodia corticola] gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] gb|OJD32691.1| 40s ribosomal protein s28 [Diplodia corticola] gb|OJD35007.1| 40s ribosomal protein s28 [Diplodia corticola] gb|OMP81426.1| 40S ribosomal protein S28 [Diplodia seriata] gb|OMP84080.1| 40S ribosomal protein S28 [Diplodia seriata] Length = 68 Score = 106 bits (265), Expect = 1e-27 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] ref|XP_008099256.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] ref|XP_018163793.1| Ribosomal protein S28e [Colletotrichum higginsianum IMI 349063] gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gb|KDN65874.1| putative 40S ribosomal protein S28 [Colletotrichum sublineola] gb|KZL71826.1| 40S ribosomal protein S28 [Colletotrichum tofieldiae] gb|OBR15276.1| Ribosomal protein S28e [Colletotrichum higginsianum IMI 349063] gb|OHW93033.1| 40s ribosomal protein s28 [Colletotrichum incanum] Length = 68 Score = 106 bits (265), Expect = 1e-27 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|PHH84408.1| hypothetical protein CDD83_1988 [Cordyceps sp. RAO-2017] Length = 68 Score = 106 bits (264), Expect = 1e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD++KAPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDTSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|KKY30575.1| putative 40s ribosomal protein s28 [Diaporthe ampelina] gb|POS76084.1| 40S ribosomal protein S28 [Diaporthe helianthi] Length = 68 Score = 106 bits (264), Expect = 1e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD++K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRENDILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRENDILC 56 >ref|XP_022583430.1| hypothetical protein ASPZODRAFT_149897 [Penicilliopsis zonata CBS 506.65] gb|OJJ48920.1| hypothetical protein ASPZODRAFT_149897 [Penicilliopsis zonata CBS 506.65] Length = 68 Score = 105 bits (263), Expect = 2e-27 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDSAKAPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVR +DILC Sbjct: 1 MDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRVDDILC 56 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] ref|XP_009652495.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] emb|CEJ91264.1| Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] emb|CRK34680.1| hypothetical protein BN1708_016348 [Verticillium longisporum] gb|PNH27090.1| hypothetical protein BJF96_g9603 [Verticillium dahliae] gb|PNH42353.1| hypothetical protein VD0004_g4919 [Verticillium dahliae] gb|PNH55608.1| hypothetical protein VD0003_g2014 [Verticillium dahliae] gb|PNH64766.1| hypothetical protein VD0002_g4022 [Verticillium dahliae] gb|PNH71048.1| hypothetical protein VD0001_g6487 [Verticillium dahliae] Length = 68 Score = 105 bits (263), Expect = 2e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDS+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] emb|CRK36463.1| hypothetical protein BN1708_007062 [Verticillium longisporum] emb|CRK15241.1| hypothetical protein BN1708_011409 [Verticillium longisporum] emb|CRK11466.1| hypothetical protein BN1723_001798 [Verticillium longisporum] gb|PNH34053.1| hypothetical protein BJF96_g2443 [Verticillium dahliae] gb|PNH41623.1| hypothetical protein VD0004_g5511 [Verticillium dahliae] gb|PNH55606.1| hypothetical protein VD0003_g2012 [Verticillium dahliae] gb|PNH58903.1| hypothetical protein VD0002_g8641 [Verticillium dahliae] gb|PNH71902.1| hypothetical protein VD0001_g5649 [Verticillium dahliae] Length = 68 Score = 105 bits (263), Expect = 2e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MDS+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|OCK76572.1| ribosomal protein S28e, partial [Lepidopterella palustris CBS 459.81] Length = 67 Score = 105 bits (262), Expect = 3e-27 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD+AK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVRENDILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|OCL01585.1| ribosomal protein S28e [Glonium stellatum] gb|ORY11270.1| ribosomal protein S28e [Clohesyomyces aquaticus] Length = 68 Score = 105 bits (262), Expect = 3e-27 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +3 Query: 36 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 203 MD+AK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVRENDILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56