BLASTX nr result
ID: Chrysanthemum21_contig00020407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00020407 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012268277.1| nucleolin-like [Athalia rosae] 54 1e-05 >ref|XP_012268277.1| nucleolin-like [Athalia rosae] Length = 558 Score = 53.5 bits (127), Expect = 1e-05 Identities = 28/78 (35%), Positives = 42/78 (53%) Frame = +2 Query: 56 RKVPMYLVAQKLPRNANYDEVYQLFDNVVESQFVLYLPLNQGEETNKGFCFTYFTSLEDY 235 +K L LP +A DE+ F V + +P + G +T +GF + FT+ EDY Sbjct: 424 KKKRYILFVGNLPFDAGTDEIRDHFQAKVGKVSSVRIPRHPGSQTKRGFAYVEFTNKEDY 483 Query: 236 RAGLGLHNSELQGKDISV 289 GL LHN+ LQG+ ++V Sbjct: 484 EKGLSLHNTLLQGRLLNV 501