BLASTX nr result
ID: Chrysanthemum21_contig00020062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00020062 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH95051.1| hypothetical protein Ccrd_002880 [Cynara carduncu... 54 6e-07 >gb|KVH95051.1| hypothetical protein Ccrd_002880 [Cynara cardunculus var. scolymus] Length = 75 Score = 53.9 bits (128), Expect = 6e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +1 Query: 1 SNFQFIRSDHGFSTSSSPSATHRRSVTTTSEFNRRSLM 114 SNF RSDHGFSTSSSPSA HRR TTSEFN R+++ Sbjct: 41 SNFHVFRSDHGFSTSSSPSAAHRR---TTSEFNSRAVV 75