BLASTX nr result
ID: Chrysanthemum21_contig00019434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00019434 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI03717.1| UDP-glucuronosyl/UDP-glucosyltransferase [Cynara ... 105 5e-23 ref|XP_023764348.1| UDP-glycosyltransferase 87A2-like [Lactuca s... 102 6e-22 gb|AJE73435.1| ribosomal protein S16 (plastid) [Antennaria howel... 89 1e-19 gb|ANS80708.1| 30S ribosomal protein S16 (chloroplast) [Ilex lat... 89 1e-19 ref|YP_009317282.1| ribosomal protein S16 (chloroplast) [Mikania... 89 1e-19 gb|ADD30030.1| ribosomal protein S16 (chloroplast) [Ilex cornuta... 89 2e-19 ref|YP_009336356.1| ribosomal protein S16 (chloroplast) [Nicotia... 88 2e-19 ref|YP_009428451.1| ribosomal protein S16 (chloroplast) [Conyza ... 88 2e-19 ref|YP_009373558.1| ribosomal protein S16 (chloroplast) [Archiba... 88 2e-19 ref|YP_009371277.1| ribosomal protein S16 (chloroplast) [Diplost... 88 2e-19 ref|YP_009460493.1| ribosomal protein S16 (plastid) [Cirsium arv... 88 2e-19 gb|ANS81183.1| 30S ribosomal protein S16 (chloroplast) [Ilex del... 88 2e-19 ref|YP_009040782.1| ribosomal protein S16 (chloroplast) (chlorop... 88 2e-19 gb|ANC95037.1| ribosomal protein S16 (chloroplast) [Dunalia spat... 88 2e-19 ref|YP_009446333.1| ribosomal protein L16 (chloroplast) [Saussur... 88 3e-19 ref|YP_001837342.1| ribosomal protein S16 [Guizotia abyssinica] ... 88 3e-19 ref|YP_009320262.1| ribosomal protein S16 (chloroplast) [Perical... 88 3e-19 ref|YP_009170245.1| ribosomal protein S16 (chloroplast) [Silybum... 88 3e-19 gb|AJE73283.1| ribosomal protein S16 (plastid) [Bidens aristosa] 88 3e-19 gb|AJE74195.1| ribosomal protein S16 (plastid) [Echinacea angust... 88 3e-19 >gb|KVI03717.1| UDP-glucuronosyl/UDP-glucosyltransferase [Cynara cardunculus var. scolymus] Length = 458 Score = 105 bits (262), Expect = 5e-23 Identities = 54/73 (73%), Positives = 62/73 (84%) Frame = +2 Query: 2 KMGKRVKIEEDSLLTREEIAKLIKSFMGRESEEGTKMRKRAKEVKKICQQAIAEGGSAQT 181 KMGKRV E SL+TREEIAKL+KSFM ESEEG +MRKRA+EV+KIC+QA EGGSA+ Sbjct: 384 KMGKRVSDYEGSLVTREEIAKLVKSFMDHESEEGKEMRKRAREVQKICRQATNEGGSAKK 443 Query: 182 DIDSFISDVLGSR 220 DIDSFISD+L SR Sbjct: 444 DIDSFISDMLNSR 456 >ref|XP_023764348.1| UDP-glycosyltransferase 87A2-like [Lactuca sativa] gb|PLY98408.1| hypothetical protein LSAT_5X174540 [Lactuca sativa] Length = 454 Score = 102 bits (254), Expect = 6e-22 Identities = 52/69 (75%), Positives = 60/69 (86%) Frame = +2 Query: 2 KMGKRVKIEEDSLLTREEIAKLIKSFMGRESEEGTKMRKRAKEVKKICQQAIAEGGSAQT 181 KMGKRV+ EE +L+TREEIAKLIK FM RESEEG +MR+RA EVKKI +QAI EGGSAQ Sbjct: 382 KMGKRVRTEEGNLVTREEIAKLIKCFMDRESEEGKEMRRRALEVKKISRQAIEEGGSAQI 441 Query: 182 DIDSFISDV 208 DIDSFI+D+ Sbjct: 442 DIDSFINDI 450 >gb|AJE73435.1| ribosomal protein S16 (plastid) [Antennaria howellii] gb|AJE73815.1| ribosomal protein S16 (plastid) [Antennaria neglecta] Length = 84 Score = 89.0 bits (219), Expect = 1e-19 Identities = 43/53 (81%), Positives = 45/53 (84%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTFLVLENALQNF 449 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F L + F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELSSNQNKF 83 >gb|ANS80708.1| 30S ribosomal protein S16 (chloroplast) [Ilex latifolia] gb|ANS80803.1| 30S ribosomal protein S16 (chloroplast) [Ilex szechwanensis] gb|ANS80898.1| 30S ribosomal protein S16 (chloroplast) [Ilex pubescens] gb|ANS80993.1| 30S ribosomal protein S16 (chloroplast) [Ilex polyneura] gb|ANS81088.1| 30S ribosomal protein S16 (chloroplast) [Ilex sp. XY-2016] gb|ANS81278.1| 30S ribosomal protein S16 (chloroplast) [Ilex wilsonii] Length = 75 Score = 88.6 bits (218), Expect = 1e-19 Identities = 43/53 (81%), Positives = 45/53 (84%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTFLVLENALQNF 449 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F L + F Sbjct: 22 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELRSNQTKF 74 >ref|YP_009317282.1| ribosomal protein S16 (chloroplast) [Mikania micrantha] gb|AOX22882.1| ribosomal protein S16 (chloroplast) [Mikania micrantha] Length = 84 Score = 88.6 bits (218), Expect = 1e-19 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTFLVL 470 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F L Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKAL 76 >gb|ADD30030.1| ribosomal protein S16 (chloroplast) [Ilex cornuta] gb|AJW59602.1| ribosomal protein S16 (chloroplast) [Ilex paraguariensis] Length = 88 Score = 88.6 bits (218), Expect = 2e-19 Identities = 43/53 (81%), Positives = 45/53 (84%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTFLVLENALQNF 449 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F L + F Sbjct: 35 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELRSNQTKF 87 >ref|YP_009336356.1| ribosomal protein S16 (chloroplast) [Nicotiana otophora] gb|ALT14451.1| ribosomal protein S16 (chloroplast) [Nicotiana otophora] Length = 73 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 23 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 65 >ref|YP_009428451.1| ribosomal protein S16 (chloroplast) [Conyza bonariensis] gb|ASW20512.1| ribosomal protein S16 (chloroplast) [Conyza bonariensis] gb|AVK42909.1| ribosomal protein S16 (chloroplast) [Conyza bonariensis] Length = 74 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_009373558.1| ribosomal protein S16 (chloroplast) [Archibaccharis asperifolia] gb|ARH03103.1| ribosomal protein S16 (chloroplast) [Archibaccharis asperifolia] Length = 74 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_009371277.1| ribosomal protein S16 (chloroplast) [Diplostephium pulchrum] ref|YP_009371362.1| ribosomal protein S16 (chloroplast) [Diplostephium jelskii] ref|YP_009372212.1| ribosomal protein S16 (chloroplast) [Diplostephium huertasii] ref|YP_009371617.1| ribosomal protein S16 (chloroplast) [Diplostephium juniperinum] ref|YP_009372467.1| ribosomal protein S16 (chloroplast) [Diplostephium obtusum] ref|YP_009371702.1| ribosomal protein S16 (chloroplast) [Diplostephium oxapampanum] ref|YP_009371447.1| ribosomal protein S16 (chloroplast) [Diplostephium lechleri] ref|YP_009371872.1| ribosomal protein S16 (chloroplast) [Diplostephium violaceum] ref|YP_009371957.1| ribosomal protein S16 (chloroplast) [Diplostephium oblongifolium] ref|YP_009371532.1| ribosomal protein S16 (chloroplast) [Lagenophora cuchumatanica] ref|YP_009371787.1| ribosomal protein S16 (chloroplast) [Diplostephium rhododendroides] ref|YP_009372127.1| ribosomal protein S16 (chloroplast) [Diplostephium juajibioyi] ref|YP_009372297.1| ribosomal protein S16 (chloroplast) [Diplostephium spinulosum] ref|YP_009372382.1| ribosomal protein S16 (chloroplast) [Diplostephium meyenii] ref|YP_009372552.1| ribosomal protein S16 (chloroplast) [Diplostephium tachirense] ref|YP_009372637.1| ribosomal protein S16 (chloroplast) [Diplostephium serratifolium] ref|YP_009372722.1| ribosomal protein S16 (chloroplast) [Diplostephium mutiscuanum] ref|YP_009372807.1| ribosomal protein S16 (chloroplast) [Diplostephium sagasteguii] ref|YP_009372892.1| ribosomal protein S16 (chloroplast) [Diplostephium jenesanum] ref|YP_009372976.1| ribosomal protein S16 (chloroplast) [Diplostephium oblanceolatum] ref|YP_009373061.1| ribosomal protein S16 (chloroplast) [Diplostephium hippophae] ref|YP_009373146.1| ribosomal protein S16 (chloroplast) [Diplostephium hartwegii] ref|YP_009373473.1| ribosomal protein S16 (chloroplast) [Diplostephium alveolatum] ref|YP_009373728.1| ribosomal protein S16 (chloroplast) [Diplostephium cinerascens] ref|YP_009374067.1| ribosomal protein S16 (chloroplast) [Diplostephium glandulosum] ref|YP_009374152.1| ribosomal protein S16 (chloroplast) [Heterothalamus alienus] ref|YP_009374237.1| ribosomal protein S16 (chloroplast) [Diplostephium callilepis] ref|YP_009374322.1| ribosomal protein S16 (chloroplast) [Diplostephium floribundum] ref|YP_009374492.1| ribosomal protein S16 (chloroplast) [Diplostephium rhomboidale] ref|YP_009374747.1| ribosomal protein S16 (chloroplast) [Diplostephium gynoxyoides] ref|YP_009375597.1| ribosomal protein S16 (chloroplast) [Diplostephium cajamarquillense] ref|YP_009376447.1| ribosomal protein S16 (chloroplast) [Diplostephium azureum] ref|YP_009376532.1| ribosomal protein S16 (chloroplast) [Diplostephium foliosissimum] ref|YP_009376787.1| ribosomal protein S16 (chloroplast) [Diplostephium cayambense] ref|YP_009376957.1| ribosomal protein S16 (chloroplast) [Floscaldasia hypsophila] ref|YP_009377127.1| ribosomal protein S16 (chloroplast) [Parastrephia quadrangularis] ref|YP_009377467.1| ribosomal protein S16 (chloroplast) [Diplostephium jaramilloi] ref|YP_009377637.1| ribosomal protein S16 (chloroplast) [Diplostephium heterophyllum] ref|YP_009377722.1| ribosomal protein S16 (chloroplast) [Diplostephium camargoanum] ref|YP_009378232.1| ribosomal protein S16 (chloroplast) [Diplostephium ochraceum] ref|YP_009373898.1| ribosomal protein S16 (chloroplast) [Baccharis genistelloides] ref|YP_009373982.1| ribosomal protein S16 (chloroplast) [Diplostephium barclayanum] ref|YP_009374577.1| ribosomal protein S16 (chloroplast) [Diplostephium tenuifolium] ref|YP_009374662.1| ribosomal protein S16 (chloroplast) [Diplostephium colombianum] ref|YP_009374917.1| ribosomal protein S16 (chloroplast) [Exostigma notobellidiastrum] ref|YP_009375002.1| ribosomal protein S16 (chloroplast) [Diplostephium rupestre] ref|YP_009375087.1| ribosomal protein S16 (chloroplast) [Blakiella bartsiifolia] ref|YP_009375172.1| ribosomal protein S16 (chloroplast) [Diplostephium gnidioides] ref|YP_009375257.1| ribosomal protein S16 (chloroplast) [Baccharis tricuneata] ref|YP_009375342.1| ribosomal protein S16 (chloroplast) [Diplostephium cinereum] ref|YP_009375427.1| ribosomal protein S16 (chloroplast) [Diplostephium ericoides] ref|YP_009375512.1| ribosomal protein S16 (chloroplast) [Diplostephium haenkei] ref|YP_009375682.1| ribosomal protein S16 (chloroplast) [Diplostephium phylicoides] ref|YP_009375767.1| ribosomal protein S16 (chloroplast) [Diplostephium eriophorum] ref|YP_009375852.1| ribosomal protein S16 (chloroplast) [Diplostephium glutinosum] ref|YP_009375937.1| ribosomal protein S16 (chloroplast) [Diplostephium antioquense] ref|YP_009376107.1| ribosomal protein S16 (chloroplast) [Diplostephium lacunosum] ref|YP_009376192.1| ribosomal protein S16 (chloroplast) [Diplostephium costaricense] ref|YP_009376362.1| ribosomal protein S16 (chloroplast) [Diplostephium crypteriophyllum] ref|YP_009376702.1| ribosomal protein S16 (chloroplast) [Diplostephium romeroi] ref|YP_009376872.1| ribosomal protein S16 (chloroplast) [Diplostephium venezuelense] ref|YP_009377212.1| ribosomal protein S16 (chloroplast) [Diplostephium empetrifolium] ref|YP_009377297.1| ribosomal protein S16 (chloroplast) [Diplostephium schultzii] ref|YP_009377382.1| ribosomal protein S16 (chloroplast) [Diplostephium frontinense] ref|YP_009377552.1| ribosomal protein S16 (chloroplast) [Diplostephium inesianum] ref|YP_009377807.1| ribosomal protein S16 (chloroplast) [Aztecaster matudae] ref|YP_009377892.1| ribosomal protein S16 (chloroplast) [Diplostephium coriaceum] ref|YP_009377977.1| ribosomal protein S16 (chloroplast) [Diplostephium rosmarinifolium] ref|YP_009378062.1| ribosomal protein S16 (chloroplast) [Diplostephium goodspeedii] ref|YP_009378147.1| ribosomal protein S16 (chloroplast) [Diplostephium apiculatum] gb|AJE73058.1| ribosomal protein S16 (plastid) [Xanthisma spinulosum] gb|AJE73134.1| ribosomal protein S16 (plastid) [Gutierrezia sarothrae] gb|AJE73362.1| ribosomal protein S16 (plastid) [Erigeron strigosus] gb|AJE73587.1| ribosomal protein S16 (plastid) [Solidago canadensis var. scabra] gb|AJE73666.1| ribosomal protein S16 (plastid) [Erigeron philadelphicus] gb|AJE74882.1| ribosomal protein S16 (plastid) [Solidago gigantea] gb|AJE75034.1| ribosomal protein S16 (plastid) [Erigeron bellidiastrum] gb|AKZ24327.1| ribosomal protein S16 (plastid) [Grindelia squarrosa var. squarrosa] gb|AKZ24328.1| ribosomal protein S16 (plastid) [Solidago missouriensis] gb|ARH02848.1| ribosomal protein S16 (chloroplast) [Diplostephium alveolatum] gb|ARH02933.1| ribosomal protein S16 (chloroplast) [Diplostephium pulchrum] gb|ARH03018.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03188.1| ribosomal protein S16 (chloroplast) [Diplostephium jelskii] gb|ARH03358.1| ribosomal protein S16 (chloroplast) [Diplostephium cinerascens] gb|ARH03528.1| ribosomal protein S16 (chloroplast) [Baccharis genistelloides] gb|ARH03612.1| ribosomal protein S16 (chloroplast) [Diplostephium barclayanum] gb|ARH03697.1| ribosomal protein S16 (chloroplast) [Diplostephium glandulosum] gb|ARH03782.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03867.1| ribosomal protein S16 (chloroplast) [Diplostephium lechleri] gb|ARH03952.1| ribosomal protein S16 (chloroplast) [Heterothalamus alienus] gb|ARH04037.1| ribosomal protein S16 (chloroplast) [Diplostephium callilepis] gb|ARH04122.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH04207.1| ribosomal protein S16 (chloroplast) [Diplostephium floribundum] gb|ARH04377.1| ribosomal protein S16 (chloroplast) [Diplostephium rhomboidale] gb|ARH04462.1| ribosomal protein S16 (chloroplast) [Diplostephium tenuifolium] gb|ARH04547.1| ribosomal protein S16 (chloroplast) [Diplostephium colombianum] gb|ARH04632.1| ribosomal protein S16 (chloroplast) [Diplostephium gynoxyoides] gb|ARH04802.1| ribosomal protein S16 (chloroplast) [Lagenophora cuchumatanica] gb|ARH04887.1| ribosomal protein S16 (chloroplast) [Diplostephium hartwegii] gb|ARH04972.1| ribosomal protein S16 (chloroplast) [Exostigma notobellidiastrum] gb|ARH05057.1| ribosomal protein S16 (chloroplast) [Diplostephium rupestre] gb|ARH05142.1| ribosomal protein S16 (chloroplast) [Diplostephium juniperinum] gb|ARH05227.1| ribosomal protein S16 (chloroplast) [Diplostephium oxapampanum] gb|ARH05312.1| ribosomal protein S16 (chloroplast) [Diplostephium rhododendroides] gb|ARH05397.1| ribosomal protein S16 (chloroplast) [Blakiella bartsiifolia] gb|ARH05482.1| ribosomal protein S16 (chloroplast) [Diplostephium gnidioides] gb|ARH05567.1| ribosomal protein S16 (chloroplast) [Baccharis tricuneata] gb|ARH05652.1| ribosomal protein S16 (chloroplast) [Diplostephium cinereum] gb|ARH05737.1| ribosomal protein S16 (chloroplast) [Diplostephium rhomboidale] gb|ARH05822.1| ribosomal protein S16 (chloroplast) [Diplostephium violaceum] gb|ARH05907.1| ribosomal protein S16 (chloroplast) [Diplostephium ericoides] gb|ARH05992.1| ribosomal protein S16 (chloroplast) [Diplostephium haenkei] gb|ARH06077.1| ribosomal protein S16 (chloroplast) [Diplostephium cajamarquillense] gb|ARH06162.1| ribosomal protein S16 (chloroplast) [Diplostephium phylicoides] gb|ARH06247.1| ribosomal protein S16 (chloroplast) [Diplostephium eriophorum] gb|ARH06332.1| ribosomal protein S16 (chloroplast) [Diplostephium glutinosum] gb|ARH06417.1| ribosomal protein S16 (chloroplast) [Diplostephium antioquense] gb|ARH06587.1| ribosomal protein S16 (chloroplast) [Diplostephium lacunosum] gb|ARH06672.1| ribosomal protein S16 (chloroplast) [Diplostephium costaricense] gb|ARH06757.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH06927.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH07012.1| ribosomal protein S16 (chloroplast) [Diplostephium crypteriophyllum] gb|ARH07097.1| ribosomal protein S16 (chloroplast) [Diplostephium oblongifolium] gb|ARH07182.1| ribosomal protein S16 (chloroplast) [Diplostephium azureum] gb|ARH07352.1| ribosomal protein S16 (chloroplast) [Diplostephium foliosissimum] gb|ARH07522.1| ribosomal protein S16 (chloroplast) [Diplostephium romeroi] gb|ARH07607.1| ribosomal protein S16 (chloroplast) [Diplostephium cayambense] gb|ARH07692.1| ribosomal protein S16 (chloroplast) [Diplostephium juajibioyi] gb|ARH07777.1| ribosomal protein S16 (chloroplast) [Diplostephium venezuelense] gb|ARH07862.1| ribosomal protein S16 (chloroplast) [Diplostephium huertasii] gb|ARH07947.1| ribosomal protein S16 (chloroplast) [Floscaldasia hypsophila] gb|ARH08032.1| ribosomal protein S16 (chloroplast) [Diplostephium spinulosum] gb|ARH08117.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH08202.1| ribosomal protein S16 (chloroplast) [Diplostephium meyenii] gb|ARH08287.1| ribosomal protein S16 (chloroplast) [Diplostephium obtusum] gb|ARH08457.1| ribosomal protein S16 (chloroplast) [Diplostephium tachirense] gb|ARH08542.1| ribosomal protein S16 (chloroplast) [Parastrephia quadrangularis] gb|ARH08627.1| ribosomal protein S16 (chloroplast) [Diplostephium serratifolium] gb|ARH08712.1| ribosomal protein S16 (chloroplast) [Diplostephium empetrifolium] gb|ARH08797.1| ribosomal protein S16 (chloroplast) [Diplostephium schultzii] gb|ARH08882.1| ribosomal protein S16 (chloroplast) [Diplostephium frontinense] gb|ARH08967.1| ribosomal protein S16 (chloroplast) [Diplostephium jaramilloi] gb|ARH09052.1| ribosomal protein S16 (chloroplast) [Diplostephium mutiscuanum] gb|ARH09137.1| ribosomal protein S16 (chloroplast) [Diplostephium inesianum] gb|ARH09222.1| ribosomal protein S16 (chloroplast) [Diplostephium heterophyllum] gb|ARH09307.1| ribosomal protein S16 (chloroplast) [Diplostephium sagasteguii] gb|ARH09392.1| ribosomal protein S16 (chloroplast) [Diplostephium camargoanum] gb|ARH09477.1| ribosomal protein S16 (chloroplast) [Diplostephium jenesanum] gb|ARH09561.1| ribosomal protein S16 (chloroplast) [Aztecaster matudae] gb|ARH09646.1| ribosomal protein S16 (chloroplast) [Diplostephium schultzii] gb|ARH09731.1| ribosomal protein S16 (chloroplast) [Diplostephium coriaceum] gb|ARH09816.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH09901.1| ribosomal protein S16 (chloroplast) [Diplostephium rosmarinifolium] gb|ARH09986.1| ribosomal protein S16 (chloroplast) [Diplostephium goodspeedii] gb|ARH10071.1| ribosomal protein S16 (chloroplast) [Diplostephium oblanceolatum] gb|ARH10156.1| ribosomal protein S16 (chloroplast) [Diplostephium pulchrum] gb|ARH10241.1| ribosomal protein S16 (chloroplast) [Diplostephium apiculatum] gb|ARH10326.1| ribosomal protein S16 (chloroplast) [Diplostephium hippophae] gb|ARH10411.1| ribosomal protein S16 (chloroplast) [Diplostephium ochraceum] gb|ARH10496.1| ribosomal protein S16 (chloroplast) [Diplostephium sp. CAJ2] Length = 74 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_009460493.1| ribosomal protein S16 (plastid) [Cirsium arvense] ref|YP_009460581.1| ribosomal protein S16 (plastid) [Cirsium eriophorum] ref|YP_009460669.1| ribosomal protein S16 (plastid) [Cirsium vulgare] gb|AUT81807.1| ribosomal protein S16 (plastid) [Cirsium arvense] gb|AUT81895.1| ribosomal protein S16 (plastid) [Cirsium eriophorum] gb|AUT81983.1| ribosomal protein S16 (plastid) [Cirsium vulgare] Length = 75 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 22 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 64 >gb|ANS81183.1| 30S ribosomal protein S16 (chloroplast) [Ilex delavayi] Length = 75 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 22 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 64 >ref|YP_009040782.1| ribosomal protein S16 (chloroplast) (chloroplast) [Centaurea diffusa] ref|YP_009235793.1| ribosomal protein S16 (chloroplast) [Saussurea involucrata] gb|AIB03736.1| ribosomal protein S16 (chloroplast) (chloroplast) [Centaurea diffusa] gb|AMD61947.1| ribosomal protein S16 (chloroplast) [Saussurea involucrata] Length = 75 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 22 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 64 >gb|ANC95037.1| ribosomal protein S16 (chloroplast) [Dunalia spathulata] Length = 78 Score = 87.8 bits (216), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 25 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 67 >ref|YP_009446333.1| ribosomal protein L16 (chloroplast) [Saussurea polylepis] ref|YP_009450364.1| ribosomal protein S16 (chloroplast) [Saussurea chabyoungsanica] gb|APZ75457.1| ribosomal protein S16 (chloroplast) [Saussurea chabyoungsanica] gb|ATY40783.1| ribosomal protein L16 (chloroplast) [Saussurea polylepis] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_001837342.1| ribosomal protein S16 [Guizotia abyssinica] gb|ACB86509.1| ribosomal protein S16 (chloroplast) [Guizotia abyssinica] gb|AJE74347.1| ribosomal protein S16 (plastid) [Thelesperma filifolium] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_009320262.1| ribosomal protein S16 (chloroplast) [Pericallis hybrida] gb|ALE65910.1| ribosomal protein S16 (chloroplast) [Pericallis hybrida] gb|ANS57976.1| ribosomal protein S16 (chloroplast) [Ligularia fischeri] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >ref|YP_009170245.1| ribosomal protein S16 (chloroplast) [Silybum marianum] gb|AJE73511.1| ribosomal protein S16 (plastid) [Cirsium undulatum] gb|AJE74803.1| ribosomal protein S16 (plastid) [Cirsium canescens] gb|AKZ24320.1| ribosomal protein S16 (plastid) [Carduus nutans] gb|ALE29269.1| ribosomal protein S16 (chloroplast) [Silybum marianum] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >gb|AJE73283.1| ribosomal protein S16 (plastid) [Bidens aristosa] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73 >gb|AJE74195.1| ribosomal protein S16 (plastid) [Echinacea angustifolia] gb|AJE74499.1| ribosomal protein S16 (plastid) [Lactuca ludoviciana] gb|AJE74727.1| ribosomal protein S16 (plastid) [Hymenopappus tenuifolius] gb|AKZ24325.1| ribosomal protein S16 (plastid) [Silphium integrifolium] gb|AKZ24326.1| ribosomal protein S16 (plastid) [Heliopsis helianthoides var. occidentalis] Length = 84 Score = 87.8 bits (216), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 607 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKADTF 479 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKA+ F Sbjct: 31 KVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVF 73