BLASTX nr result
ID: Chrysanthemum21_contig00019087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00019087 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021984254.1| ubiquitin receptor RAD23b-like [Helianthus a... 147 3e-40 ref|XP_023744149.1| ubiquitin receptor RAD23b [Lactuca sativa] >... 145 8e-40 gb|KVI06100.1| Heat shock chaperonin-binding [Cynara cardunculus... 143 1e-38 ref|XP_022015926.1| ubiquitin receptor RAD23b-like [Helianthus a... 137 1e-36 gb|PON68282.1| UV excision repair protein Rad [Trema orientalis] 129 1e-36 gb|PON52756.1| UV excision repair protein Rad [Parasponia anders... 129 1e-36 gb|OMO67419.1| hypothetical protein COLO4_30171 [Corchorus olito... 134 2e-35 gb|PPD94262.1| hypothetical protein GOBAR_DD08738 [Gossypium bar... 134 2e-35 ref|XP_022715400.1| ubiquitin receptor RAD23b-like isoform X3 [D... 134 2e-35 gb|PIA46046.1| hypothetical protein AQUCO_01600369v1 [Aquilegia ... 134 2e-35 ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragar... 134 3e-35 ref|XP_022715399.1| ubiquitin receptor RAD23b-like isoform X2 [D... 134 3e-35 ref|XP_016683585.1| PREDICTED: ubiquitin receptor RAD23b-like [G... 134 3e-35 ref|XP_012451888.1| PREDICTED: ubiquitin receptor RAD23b-like [G... 134 3e-35 ref|XP_022715398.1| ubiquitin receptor RAD23b-like isoform X1 [D... 134 4e-35 ref|XP_017643432.1| PREDICTED: ubiquitin receptor RAD23b-like is... 132 5e-35 gb|AEA86336.1| putative DNA repair protein, partial [Solanum nig... 128 5e-35 ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarp... 133 5e-35 ref|XP_021650549.1| ubiquitin receptor RAD23b-like isoform X2 [H... 132 6e-35 ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [P... 133 6e-35 >ref|XP_021984254.1| ubiquitin receptor RAD23b-like [Helianthus annuus] ref|XP_021984255.1| ubiquitin receptor RAD23b-like [Helianthus annuus] gb|OTG16699.1| putative UV excision repair protein Rad23, UBA-like, Ubiquitin-related domain protein [Helianthus annuus] Length = 372 Score = 147 bits (370), Expect = 3e-40 Identities = 73/74 (98%), Positives = 74/74 (100%) Frame = -1 Query: 384 EFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLACD 205 EFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGF+RTLVIEAFLACD Sbjct: 294 EFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFDRTLVIEAFLACD 353 Query: 204 RNEELAANFLLENA 163 RNEELAANFLLENA Sbjct: 354 RNEELAANFLLENA 367 >ref|XP_023744149.1| ubiquitin receptor RAD23b [Lactuca sativa] gb|PLY65929.1| hypothetical protein LSAT_4X84860 [Lactuca sativa] Length = 356 Score = 145 bits (366), Expect = 8e-40 Identities = 73/75 (97%), Positives = 74/75 (98%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEPVDASEGDLFDQ DQEMPHAISVTPEEQEAIERLEAMGF+RTLVIEAFLAC Sbjct: 277 AEFLQLINEPVDASEGDLFDQPDQEMPHAISVTPEEQEAIERLEAMGFDRTLVIEAFLAC 336 Query: 207 DRNEELAANFLLENA 163 DRNEELAANFLLENA Sbjct: 337 DRNEELAANFLLENA 351 >gb|KVI06100.1| Heat shock chaperonin-binding [Cynara cardunculus var. scolymus] Length = 385 Score = 143 bits (360), Expect = 1e-38 Identities = 72/75 (96%), Positives = 73/75 (97%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEPVDASEGDLFDQ DQEMPHAISVTP EQEAIERLEAMGF+RTLVIEAFLAC Sbjct: 306 AEFLQLINEPVDASEGDLFDQPDQEMPHAISVTPAEQEAIERLEAMGFDRTLVIEAFLAC 365 Query: 207 DRNEELAANFLLENA 163 DRNEELAANFLLENA Sbjct: 366 DRNEELAANFLLENA 380 >ref|XP_022015926.1| ubiquitin receptor RAD23b-like [Helianthus annuus] gb|OTF90425.1| putative rad23 UV excision repair protein family [Helianthus annuus] Length = 376 Score = 137 bits (346), Expect = 1e-36 Identities = 71/77 (92%), Positives = 73/77 (94%), Gaps = 2/77 (2%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQG--DQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFL 214 AEFLQLINEPVDASEGDLFDQ DQEMPHAISVTP EQEAIERLEAMGF+RTLVIEAFL Sbjct: 295 AEFLQLINEPVDASEGDLFDQAEADQEMPHAISVTPAEQEAIERLEAMGFDRTLVIEAFL 354 Query: 213 ACDRNEELAANFLLENA 163 ACDRNEELAAN+LLENA Sbjct: 355 ACDRNEELAANYLLENA 371 >gb|PON68282.1| UV excision repair protein Rad [Trema orientalis] Length = 100 Score = 129 bits (325), Expect = 1e-36 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP + SEGD+FDQ +Q+MPHAI+VTP EQEAIERLEAMGFER LVIEAFLAC Sbjct: 21 AEFLQLINEPHEGSEGDIFDQPEQDMPHAINVTPAEQEAIERLEAMGFERALVIEAFLAC 80 Query: 207 DRNEELAANFLLENA 163 DRNE+LAAN+LLENA Sbjct: 81 DRNEQLAANYLLENA 95 >gb|PON52756.1| UV excision repair protein Rad [Parasponia andersonii] Length = 100 Score = 129 bits (325), Expect = 1e-36 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP + SEGD+FDQ +Q+MPHAI+VTP EQEAIERLEAMGFER LVIEAFLAC Sbjct: 21 AEFLQLINEPHEGSEGDIFDQPEQDMPHAINVTPAEQEAIERLEAMGFERALVIEAFLAC 80 Query: 207 DRNEELAANFLLENA 163 DRNE+LAAN+LLENA Sbjct: 81 DRNEQLAANYLLENA 95 >gb|OMO67419.1| hypothetical protein COLO4_30171 [Corchorus olitorius] gb|OMO70500.1| hypothetical protein CCACVL1_18861 [Corchorus capsularis] Length = 373 Score = 134 bits (338), Expect = 2e-35 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ DQEMPHAI+VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 294 AEFLQLINEPLEGSEGDIFDQADQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLAC 353 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 354 DRNEELAANYLLENA 368 >gb|PPD94262.1| hypothetical protein GOBAR_DD08738 [Gossypium barbadense] Length = 350 Score = 134 bits (336), Expect = 2e-35 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ +QEMPHAISVTP EQEAI+RLEAMGFER LVIEAFLAC Sbjct: 271 AEFLQLINEPLEGSEGDVFDQAEQEMPHAISVTPAEQEAIQRLEAMGFERALVIEAFLAC 330 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 331 DRNEELAANYLLENA 345 >ref|XP_022715400.1| ubiquitin receptor RAD23b-like isoform X3 [Durio zibethinus] Length = 358 Score = 134 bits (336), Expect = 2e-35 Identities = 63/75 (84%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP+D SEGD+FDQ +Q+MPHA++VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 279 AEFLQLINEPIDGSEGDIFDQAEQDMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLAC 338 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 339 DRNEELAANYLLENA 353 >gb|PIA46046.1| hypothetical protein AQUCO_01600369v1 [Aquilegia coerulea] gb|PIA46047.1| hypothetical protein AQUCO_01600369v1 [Aquilegia coerulea] Length = 395 Score = 134 bits (338), Expect = 2e-35 Identities = 65/75 (86%), Positives = 72/75 (96%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEPV+ +EGDLF+Q DQ+MPHAISVTP EQE+IERLEAMGF+RTLVIEAFLAC Sbjct: 316 AEFLQLINEPVEGAEGDLFEQADQDMPHAISVTPAEQESIERLEAMGFDRTLVIEAFLAC 375 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 376 DRNEELAANYLLENA 390 >ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca] Length = 371 Score = 134 bits (336), Expect = 3e-35 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ DQEMPHAI+VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 292 AEFLQLINEPLEGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLAC 351 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 352 DRNEELAANYLLENA 366 >ref|XP_022715399.1| ubiquitin receptor RAD23b-like isoform X2 [Durio zibethinus] Length = 373 Score = 134 bits (336), Expect = 3e-35 Identities = 63/75 (84%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP+D SEGD+FDQ +Q+MPHA++VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 294 AEFLQLINEPIDGSEGDIFDQAEQDMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLAC 353 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 354 DRNEELAANYLLENA 368 >ref|XP_016683585.1| PREDICTED: ubiquitin receptor RAD23b-like [Gossypium hirsutum] Length = 373 Score = 134 bits (336), Expect = 3e-35 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ +QEMPHAISVTP EQEAI+RLEAMGFER LVIEAFLAC Sbjct: 294 AEFLQLINEPLEGSEGDVFDQAEQEMPHAISVTPAEQEAIQRLEAMGFERALVIEAFLAC 353 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 354 DRNEELAANYLLENA 368 >ref|XP_012451888.1| PREDICTED: ubiquitin receptor RAD23b-like [Gossypium raimondii] Length = 373 Score = 134 bits (336), Expect = 3e-35 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ +QEMPHAISVTP EQEAI+RLEAMGFER LVIEAFLAC Sbjct: 294 AEFLQLINEPLEGSEGDVFDQAEQEMPHAISVTPAEQEAIQRLEAMGFERALVIEAFLAC 353 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 354 DRNEELAANYLLENA 368 >ref|XP_022715398.1| ubiquitin receptor RAD23b-like isoform X1 [Durio zibethinus] Length = 385 Score = 134 bits (336), Expect = 4e-35 Identities = 63/75 (84%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP+D SEGD+FDQ +Q+MPHA++VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 306 AEFLQLINEPIDGSEGDIFDQAEQDMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLAC 365 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 366 DRNEELAANYLLENA 380 >ref|XP_017643432.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Gossypium arboreum] Length = 306 Score = 132 bits (331), Expect = 5e-35 Identities = 64/75 (85%), Positives = 70/75 (93%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ +QEMPHAISVTP EQEAI+RLE MGFER LVIEAFLAC Sbjct: 227 AEFLQLINEPLEGSEGDVFDQAEQEMPHAISVTPAEQEAIQRLEEMGFERALVIEAFLAC 286 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 287 DRNEELAANYLLENA 301 >gb|AEA86336.1| putative DNA repair protein, partial [Solanum nigrum] Length = 172 Score = 128 bits (321), Expect = 5e-35 Identities = 61/74 (82%), Positives = 67/74 (90%) Frame = -1 Query: 384 EFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLACD 205 EFLQLINEPVD S+GD+FD DQE+PH +SVTPEEQE IERLEAMGF+R LVIEAFLACD Sbjct: 95 EFLQLINEPVDGSDGDMFDLADQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACD 154 Query: 204 RNEELAANFLLENA 163 RNEELAAN+LLE A Sbjct: 155 RNEELAANYLLEQA 168 >ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa] gb|PNT46346.1| hypothetical protein POPTR_003G186600v3 [Populus trichocarpa] Length = 358 Score = 133 bits (334), Expect = 5e-35 Identities = 64/75 (85%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP+D SEGD+FDQ DQ+MPHAI+VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 279 AEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLAC 338 Query: 207 DRNEELAANFLLENA 163 DRNE+LAAN+LLENA Sbjct: 339 DRNEQLAANYLLENA 353 >ref|XP_021650549.1| ubiquitin receptor RAD23b-like isoform X2 [Hevea brasiliensis] Length = 319 Score = 132 bits (331), Expect = 6e-35 Identities = 64/75 (85%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP++ SEGD+FDQ DQ+MPHAI+VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 240 AEFLQLINEPLEESEGDIFDQVDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLAC 299 Query: 207 DRNEELAANFLLENA 163 DRNEELAAN+LLENA Sbjct: 300 DRNEELAANYLLENA 314 >ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica] Length = 372 Score = 133 bits (334), Expect = 6e-35 Identities = 64/75 (85%), Positives = 71/75 (94%) Frame = -1 Query: 387 AEFLQLINEPVDASEGDLFDQGDQEMPHAISVTPEEQEAIERLEAMGFERTLVIEAFLAC 208 AEFLQLINEP+D SEGD+FDQ DQ+MPHAI+VTP EQEAIERLEAMGF+R LVIEAFLAC Sbjct: 293 AEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLAC 352 Query: 207 DRNEELAANFLLENA 163 DRNE+LAAN+LLENA Sbjct: 353 DRNEQLAANYLLENA 367