BLASTX nr result
ID: Chrysanthemum21_contig00019000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00019000 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023747899.1| WD repeat-containing protein 89 homolog [Lac... 65 3e-09 ref|XP_010038201.1| PREDICTED: WD repeat-containing protein 89 h... 65 3e-09 ref|XP_022035453.1| WD repeat-containing protein 89 homolog [Hel... 63 2e-08 gb|PIN11320.1| WD40 repeat protein [Handroanthus impetiginosus] 63 2e-08 ref|XP_011079679.1| WD repeat-containing protein 89 homolog [Ses... 61 7e-08 ref|XP_017231740.1| PREDICTED: WD repeat-containing protein 89 h... 60 1e-07 gb|PKI32189.1| hypothetical protein CRG98_047425 [Punica granatum] 60 2e-07 gb|OWM63540.1| hypothetical protein CDL15_Pgr019490 [Punica gran... 60 2e-07 ref|XP_021907109.1| WD repeat-containing protein 89 homolog isof... 59 3e-07 ref|XP_018815226.1| PREDICTED: WD repeat-containing protein 89 h... 59 3e-07 ref|XP_018815225.1| PREDICTED: WD repeat-containing protein 89 h... 59 3e-07 ref|XP_021907108.1| WD repeat-containing protein 89 homolog isof... 59 4e-07 ref|XP_019164127.1| PREDICTED: WD repeat-containing protein 89 h... 59 4e-07 gb|PIA61451.1| hypothetical protein AQUCO_00300747v1 [Aquilegia ... 59 4e-07 ref|XP_023884123.1| WD repeat-containing protein 89 homolog [Que... 59 4e-07 gb|POF22624.1| wd repeat-containing protein 89 like [Quercus suber] 59 5e-07 gb|POF22623.1| wd repeat-containing protein 89 like [Quercus suber] 59 5e-07 gb|PON96566.1| WD repeat containing protein [Trema orientalis] 59 6e-07 gb|PON65691.1| WD repeat containing protein [Parasponia andersonii] 59 6e-07 ref|XP_022143440.1| WD repeat-containing protein 89 homolog [Mom... 59 6e-07 >ref|XP_023747899.1| WD repeat-containing protein 89 homolog [Lactuca sativa] gb|PLY63047.1| hypothetical protein LSAT_8X53441 [Lactuca sativa] Length = 396 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S +V+CLNAGPSQEIFSFSFGG+ D LLAAGCKSQ++ Sbjct: 113 SYQQVSCLNAGPSQEIFSFSFGGSGDHLLAAGCKSQIL 150 >ref|XP_010038201.1| PREDICTED: WD repeat-containing protein 89 homolog [Eucalyptus grandis] gb|KCW50022.1| hypothetical protein EUGRSUZ_K03468 [Eucalyptus grandis] Length = 398 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S EV+C++AGPSQEIFSFSFGG+SD+LL+AGCKSQ++ Sbjct: 120 SFKEVSCISAGPSQEIFSFSFGGSSDSLLSAGCKSQIL 157 >ref|XP_022035453.1| WD repeat-containing protein 89 homolog [Helianthus annuus] gb|OTG29054.1| putative transducin/WD40 repeat-like superfamily protein [Helianthus annuus] Length = 385 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S +V+CLNAGPSQEIFSFSFGG+ LLAAGCKSQ++ Sbjct: 107 SYQQVSCLNAGPSQEIFSFSFGGSDGNLLAAGCKSQIV 144 >gb|PIN11320.1| WD40 repeat protein [Handroanthus impetiginosus] Length = 388 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S +V+C+N GPSQE+FSFSFGG D LLAAGCKSQ++ Sbjct: 111 SFQQVSCINTGPSQEVFSFSFGGAGDNLLAAGCKSQIL 148 >ref|XP_011079679.1| WD repeat-containing protein 89 homolog [Sesamum indicum] Length = 386 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S +V+C+NAG SQE+FSFSFGG D LLAAGCKSQ++ Sbjct: 111 SFQQVSCINAGSSQEVFSFSFGGAGDNLLAAGCKSQIL 148 >ref|XP_017231740.1| PREDICTED: WD repeat-containing protein 89 homolog [Daucus carota subsp. sativus] gb|KZN04961.1| hypothetical protein DCAR_005798 [Daucus carota subsp. sativus] Length = 382 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S E++C++AGPS+E+F FSFGG D+LLAAGCKSQ++ Sbjct: 105 SFQEISCISAGPSEEVFCFSFGGVGDSLLAAGCKSQIL 142 >gb|PKI32189.1| hypothetical protein CRG98_047425 [Punica granatum] Length = 389 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 EV+C++AGPSQEIFSFSFGG++ LL+AGCKSQ++ Sbjct: 112 EVSCISAGPSQEIFSFSFGGSNSVLLSAGCKSQIL 146 >gb|OWM63540.1| hypothetical protein CDL15_Pgr019490 [Punica granatum] Length = 1895 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 EV+C++AGPSQEIFSFSFGG++ LL+AGCKSQ++ Sbjct: 1630 EVSCISAGPSQEIFSFSFGGSNSVLLSAGCKSQIL 1664 >ref|XP_021907109.1| WD repeat-containing protein 89 homolog isoform X2 [Carica papaya] Length = 245 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 +V+C+ AGP+QEIFSFSFGG++D LLA GCKSQV+ Sbjct: 71 QVSCIAAGPNQEIFSFSFGGSADNLLAGGCKSQVL 105 >ref|XP_018815226.1| PREDICTED: WD repeat-containing protein 89 homolog isoform X2 [Juglans regia] Length = 338 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S EV+C++AG SQE+FSFSFGG++D LLAAGC+SQ++ Sbjct: 61 SFQEVSCISAGNSQEVFSFSFGGSNDNLLAAGCQSQIL 98 >ref|XP_018815225.1| PREDICTED: WD repeat-containing protein 89 homolog isoform X1 [Juglans regia] Length = 388 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S EV+C++AG SQE+FSFSFGG++D LLAAGC+SQ++ Sbjct: 111 SFQEVSCISAGNSQEVFSFSFGGSNDNLLAAGCQSQIL 148 >ref|XP_021907108.1| WD repeat-containing protein 89 homolog isoform X1 [Carica papaya] Length = 298 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 +V+C+ AGP+QEIFSFSFGG++D LLA GCKSQV+ Sbjct: 124 QVSCIAAGPNQEIFSFSFGGSADNLLAGGCKSQVL 158 >ref|XP_019164127.1| PREDICTED: WD repeat-containing protein 89 homolog [Ipomoea nil] Length = 388 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 S ++V+C+NAG SQE+FSFSFGG +D L+AAGC SQ++ Sbjct: 111 SFHQVSCINAGASQEVFSFSFGGAADNLVAAGCNSQIL 148 >gb|PIA61451.1| hypothetical protein AQUCO_00300747v1 [Aquilegia coerulea] Length = 396 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -3 Query: 209 LKGEHLDSVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVML 72 L+ + + N+V+ LNAGP QE++SFSFGG S+ LLAAGCKS+V++ Sbjct: 112 LRAWDIRTFNQVSQLNAGPQQEVYSFSFGGLSNNLLAAGCKSEVLI 157 >ref|XP_023884123.1| WD repeat-containing protein 89 homolog [Quercus suber] Length = 403 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 +V+C++AG SQE+FSFSFGG++D LLAAGCKSQ++ Sbjct: 128 QVSCISAGDSQEVFSFSFGGSTDNLLAAGCKSQIL 162 >gb|POF22624.1| wd repeat-containing protein 89 like [Quercus suber] Length = 430 Score = 58.9 bits (141), Expect = 5e-07 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 +V+C++AG SQE+FSFSFGG++D LLAAGCKSQ++ Sbjct: 155 QVSCISAGDSQEVFSFSFGGSTDNLLAAGCKSQIL 189 >gb|POF22623.1| wd repeat-containing protein 89 like [Quercus suber] Length = 439 Score = 58.9 bits (141), Expect = 5e-07 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 +V+C++AG SQE+FSFSFGG++D LLAAGCKSQ++ Sbjct: 155 QVSCISAGDSQEVFSFSFGGSTDNLLAAGCKSQIL 189 >gb|PON96566.1| WD repeat containing protein [Trema orientalis] Length = 386 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 EV+ ++AGPSQEIFSFSFGG++D LL+AGCKSQ++ Sbjct: 112 EVSSMSAGPSQEIFSFSFGGSTDNLLSAGCKSQIL 146 >gb|PON65691.1| WD repeat containing protein [Parasponia andersonii] Length = 386 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 179 EVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 EV+ ++AGPSQEIFSFSFGG++D LL+AGCKSQ++ Sbjct: 112 EVSSISAGPSQEIFSFSFGGSTDNLLSAGCKSQIL 146 >ref|XP_022143440.1| WD repeat-containing protein 89 homolog [Momordica charantia] Length = 391 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/38 (63%), Positives = 35/38 (92%) Frame = -3 Query: 188 SVNEVACLNAGPSQEIFSFSFGGTSDTLLAAGCKSQVM 75 ++NE++ ++AGPSQEIFSF++GG+S LLAAGCKSQ++ Sbjct: 113 ALNEISSISAGPSQEIFSFAYGGSSTNLLAAGCKSQIL 150